(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE412

PENCW_16.PE412       Location/Qualifiers
FT   CDS             join(940490..940520,940581..940649,940706..941033,
FT                   941084..941462)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196076" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15948911"
FT                   /orf_name="Pc20g04120"
FT                   /product="Pc20g04120 protein"
FT                   /protein_id="CAP85741.1"
FT                   /db_xref="InterPro:IPR016509"
FT                   /db_xref="UniParc:UPI00018314A0"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD97"
FT                   /transl_table=1
FT                   /translation="MAVPFAQRWARFVPVVGYHHVLMIIVAVAIILLSLLLAGCSSSSP
FT                   QIPDIFLISLYYERYNPIMDLAQVQPDVASPISHIVGGAEMEVRVGYFGICVQPDKGSF
FT                   ICNANATALAEIVTVDQDPMNLIWVASTFKDAVVFPYLLIVAVILAFFCFILLATFPGW
FT                   HEELNEDGSDHEVKPFPSRAVSQAALALIFVASVFVLVSVLWQHTASVAASTIAQDMGN
FT                   GSVKSGVGASAMVLGWFGFVLLVIVTVGLLFMILSIRLITKMTDDE"
     MAVPFAQRWA RFVPVVGYHH VLMIIVAVAI ILLSLLLAGC SSSSPQIPDI FLISLYYERY        60
     NPIMDLAQVQ PDVASPISHI VGGAEMEVRV GYFGICVQPD KGSFICNANA TALAEIVTVD       120
     QDPMNLIWVA STFKDAVVFP YLLIVAVILA FFCFILLATF PGWHEELNED GSDHEVKPFP       180
     SRAVSQAALA LIFVASVFVL VSVLWQHTAS VAASTIAQDM GNGSVKSGVG ASAMVLGWFG       240
     FVLLVIVTVG LLFMILSIRL ITKMTDDE                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page