(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE413

PENCW_16.PE413       Location/Qualifiers
FT   CDS             join(complement(943836..944136),complement(943551..943735))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18128998"
FT                   /orf_name="Pc20g04130"
FT                   /product="Putative uncharacterized protein Pc20g04130 "
FT                   /protein_id="CAP85742.1"
FT                   /db_xref="UniParc:UPI00018314A1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD98"
FT                   /transl_table=1
FT                   /translation="MALPSIDHSSSHPGVYLSCFAQISDQRLQGPADHLISTTNQDYGV
FT                   SSGLYAGSSVKSVSGRCIDHAKGTRPEVVQKFVWFWPKSKFPKSSRTQQAASEERASRQ
FT                   ELPMLDINMESTQLHARPSSELMKIVRTVSASREALLGDGARSLLHSMGRSQDPSHD"
     MALPSIDHSS SHPGVYLSCF AQISDQRLQG PADHLISTTN QDYGVSSGLY AGSSVKSVSG        60
     RCIDHAKGTR PEVVQKFVWF WPKSKFPKSS RTQQAASEER ASRQELPMLD INMESTQLHA       120
     RPSSELMKIV RTVSASREAL LGDGARSLLH SMGRSQDPSH D                           161
//

If you have problems or comments...

PBIL Back to PBIL home page