(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE414

PENCW_16.PE414       Location/Qualifiers
FT   CDS             join(complement(947302..947383),complement(947192..947239),
FT                   complement(946956..947137),complement(946630..946898),
FT                   complement(945492..946566))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196098" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824903"
FT                   /orf_name="Pc20g04140"
FT                   /product="Pc20g04140 protein"
FT                   /protein_id="CAP85743.1"
FT                   /db_xref="InterPro:IPR018812"
FT                   /db_xref="UniParc:UPI00018314A2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HD99"
FT                   /transl_table=1
FT                   /translation="MSYSAGGIRPHTITSLRRWSVVNKELPAVSSIRAIHVYDFDNTLF
FT                   LSPLPNPQLWHGSSIGFLQTNDCFATGGWWHDPNILSATGKGMEIEEPRKWEGWWNEQI
FT                   LGLVRNSMEQKDALTVLLTGRSEAGFAEIIKRMAASQNLEFDLIGLKPEVGPNGQRFAS
FT                   TMNFKQNFLEDLVFTYEQAAEIRVYEDRVRHVKGFRDFFENVNRDLQSGPSTARMPILA
FT                   EVIQVTEGCTYLDPVTETAEVQRMVNAHNLALRNPALNLTKSHCGRMYIKRVVFYTGYL
FT                   VSPQVSNDMMQNLLAPMLPAGLAESNDLKYMANSILITPRPAPRSVLDKVGGLGKKLKW
FT                   QVTGTGTLDNKIWAARVAPIPATEAYYTENPLPIVVLAVRKGARLIDAGQIQNWHPIPA
FT                   DRAMTFDTVVGEKVVLRVEDSGEHRQGERPLNRSQKRRFQQEDENIVWPPGSNADAPSP
FT                   GRGNYQSSQRGGGEGRRQYDDSPRGRGAHRGRGRGSGRGRGNNNRGRGRGRGRGEYYQY
FT                   RSLDDHSNGYDGQYDGKNGHNGGGSGRGGYSMDY"
     MSYSAGGIRP HTITSLRRWS VVNKELPAVS SIRAIHVYDF DNTLFLSPLP NPQLWHGSSI        60
     GFLQTNDCFA TGGWWHDPNI LSATGKGMEI EEPRKWEGWW NEQILGLVRN SMEQKDALTV       120
     LLTGRSEAGF AEIIKRMAAS QNLEFDLIGL KPEVGPNGQR FASTMNFKQN FLEDLVFTYE       180
     QAAEIRVYED RVRHVKGFRD FFENVNRDLQ SGPSTARMPI LAEVIQVTEG CTYLDPVTET       240
     AEVQRMVNAH NLALRNPALN LTKSHCGRMY IKRVVFYTGY LVSPQVSNDM MQNLLAPMLP       300
     AGLAESNDLK YMANSILITP RPAPRSVLDK VGGLGKKLKW QVTGTGTLDN KIWAARVAPI       360
     PATEAYYTEN PLPIVVLAVR KGARLIDAGQ IQNWHPIPAD RAMTFDTVVG EKVVLRVEDS       420
     GEHRQGERPL NRSQKRRFQQ EDENIVWPPG SNADAPSPGR GNYQSSQRGG GEGRRQYDDS       480
     PRGRGAHRGR GRGSGRGRGN NNRGRGRGRG RGEYYQYRSL DDHSNGYDGQ YDGKNGHNGG       540
     GSGRGGYSMD Y                                                            551
//

If you have problems or comments...

PBIL Back to PBIL home page