(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE415

PENCW_16.PE415       Location/Qualifiers
FT   CDS             join(947624..947825,947880..948706)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196109" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978095"
FT                   /orf_name="Pc20g04150"
FT                   /product="Pc20g04150 protein"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85744.1"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001841"
FT                   /db_xref="InterPro:IPR013083"
FT                   /db_xref="InterPro:IPR018957"
FT                   /db_xref="UniParc:UPI00018314A3"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA0"
FT                   /transl_table=1
FT                   /translation="MDDVELRQEILQRTLKEVADEEKEAANPCVICLDTIAEPCVAQPC
FT                   HHTNFDFLCLVSWIEQQPKCPLCKIELTAVQYDLNATQGPKLYKLPPPSAAIPAAPASA
FT                   RLRPGNRYGPRGRRPPPLPPPQPDDPLERRRNVYRNQTYSMRVGSNRLSQYRELTPELF
FT                   ARDEGLVSRARKWIRRELRVFSFLNPEPEDVERTSHQVSRPGPQRLENRRANNAEFLLE
FT                   YVIAILRTVDLKGSAGQAEDLLRDFIGRENACLFLHELQAWLRSPYNSLEDWDRHVQYS
FT                   NTPRSTSHGSYRDSDDLGRRSTPVHTRGRPQRFRRPYRSRSQENIDRSRRLQQAQQRYN
FT                   PY"
     MDDVELRQEI LQRTLKEVAD EEKEAANPCV ICLDTIAEPC VAQPCHHTNF DFLCLVSWIE        60
     QQPKCPLCKI ELTAVQYDLN ATQGPKLYKL PPPSAAIPAA PASARLRPGN RYGPRGRRPP       120
     PLPPPQPDDP LERRRNVYRN QTYSMRVGSN RLSQYRELTP ELFARDEGLV SRARKWIRRE       180
     LRVFSFLNPE PEDVERTSHQ VSRPGPQRLE NRRANNAEFL LEYVIAILRT VDLKGSAGQA       240
     EDLLRDFIGR ENACLFLHEL QAWLRSPYNS LEDWDRHVQY SNTPRSTSHG SYRDSDDLGR       300
     RSTPVHTRGR PQRFRRPYRS RSQENIDRSR RLQQAQQRYN PY                          342
//

If you have problems or comments...

PBIL Back to PBIL home page