(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE416

PENCW_16.PE416       Location/Qualifiers
FT   CDS             join(complement(949467..949740),complement(949231..949292))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978096"
FT                   /orf_name="Pc20g04160"
FT                   /product="Putative uncharacterized protein Pc20g04160 "
FT                   /protein_id="CAP85745.1"
FT                   /db_xref="UniParc:UPI00018314A4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA1"
FT                   /transl_table=1
FT                   /translation="MAQPLVPLLGSRGHREECMSLPISTPACLPARLEVIPTPQSQDDR
FT                   AAAPSQLHQAGSEEKTLRKFVGAYKSIIENLDRIEPDIDDLKRLHEHISRKKIGGTRLN
FT                   LTVRGLD"
     MAQPLVPLLG SRGHREECMS LPISTPACLP ARLEVIPTPQ SQDDRAAAPS QLHQAGSEEK        60
     TLRKFVGAYK SIIENLDRIE PDIDDLKRLH EHISRKKIGG TRLNLTVRGL D                111
//

If you have problems or comments...

PBIL Back to PBIL home page