(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE42

PENCW_16.PE42        Location/Qualifiers
FT   CDS             94327..98433
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187531" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946687"
FT                   /orf_name="Pc20g00420"
FT                   /product="Pc20g00420 protein"
FT                   /protein_id="CAP85371.1"
FT                   /db_xref="InterPro:IPR007187"
FT                   /db_xref="InterPro:IPR014908"
FT                   /db_xref="UniParc:UPI00018319E1"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD8"
FT                   /transl_table=1
FT                   /translation="MFVPKAGGRNTRRRQRTSSDDSVKPPKAKRQRSVLRRPDESPSDT
FT                   NLGRELAKLATPTTPNGDIAPTDQMSELHLSTRVVKQGDVSGNNNEGTVVLVGYFISLR
FT                   VPSDSQVQTANLLGSKSSTDFYTVDQLPSLPDQIRGLQSGISNSIAFSHLGLRFVDTHP
FT                   LNAEPLKCFFGPGHDHALALTRSHAIVWPYSAPASSPSPSETFTVSIPESCRDPKGAVP
FT                   LGVLLSTATGDHPGLLVIIPSTGKVVYWETVSSAASLGLSRQKQNGIQGSTPGMLSGEY
FT                   ATDILNGEPSGIIVTFSSGRVAHITLRDPQGKPSVLVNFLRSTAGTGGGGIFGGLKNVF
FT                   AGGSWRKEVTAVRAGGSHQRGQRDVIIATSTGLVEIWDTHWNHGNTLKKRYDLKEEILA
FT                   ALPEYHAQPTNDTELKVADFAFSTLQSSDDAVQLSDGSWRLFLVVRSPQWLETRALFVA
FT                   QVHLSGNESRVMSTHAVDLRHIPASQLETSKPKIFVPKPEETAFILIGQSLVILSLTSV
FT                   EESPSSQLLLDSNKLPLPFQDTIHLRSGTDHEILGSMSEDQSNDSPCAACVLMLRNFGV
FT                   IRVTVLPRPGIEQDVDEPQVTAKHKLEQAVFFGTMAKNPLNLSSEGDLNFPPSEMEQAS
FT                   LEICRELLQSETRFIPTTAISLEQNLRLRAKALDDLASLLSRQGNPVSRPARWELLWAA
FT                   EKIAAQRAMWKVQEACKIKNGEEGPFLSHVIASMHDKFKTPINPQQGETDPVRQWFLRD
FT                   SYRMEHIIPWIKNAIKLGRSNTSNPARALSEKILAASELFLAVTETAFRYRDEHVALYG
FT                   LRGDFLEDGVLSDGYEDLPEFWTSRGVGYSEAGHLLDLELDSCRSWKTPASAADAPDTH
FT                   VLNQVAKNSYRHLRVIGQMHLERTRWLSAQGDPKLMDESVSIEQAHVEDRKWQLFKLAG
FT                   IDHLADAVELAESFRDMGALVELIIELQDQKATQHPQPPSDVSTNQTDIDADQLIAKYF
FT                   DKFGDIWADAYFSRQIAMGYPGTLFTMRKYQSAVTRFLRSNPAYSRLSWINDVIGEDDY
FT                   DTAATSLEDLAIGSEKDLWSHRVEISLAKLGKLATKERMDSPVVASTLQEDVKRLDDYV
FT                   EVDGIQDILYSHIQPILQGAIDRKAELELVLDQCGEHIFEDRPSLHEILSDALFTLIER
FT                   QVVGADGLIDILTLMGPAQLADDTEGELVRSEFHLALQVLDYGRYGQRDPSYLTALRRL
FT                   IWRRCLIKDDWVARGKAAEGPNGNASNLVADTTLYRSLTACLEGDFVPNINTWTIELTS
FT                   VPCLEPRNAGLHSLYTPLSPAEALMTDSDSDILVSRFRPEQKSRVASDLQTENDILRQC
FT                   IEVGKLDFWFQNLRETAEVHISPPE"
     MFVPKAGGRN TRRRQRTSSD DSVKPPKAKR QRSVLRRPDE SPSDTNLGRE LAKLATPTTP        60
     NGDIAPTDQM SELHLSTRVV KQGDVSGNNN EGTVVLVGYF ISLRVPSDSQ VQTANLLGSK       120
     SSTDFYTVDQ LPSLPDQIRG LQSGISNSIA FSHLGLRFVD THPLNAEPLK CFFGPGHDHA       180
     LALTRSHAIV WPYSAPASSP SPSETFTVSI PESCRDPKGA VPLGVLLSTA TGDHPGLLVI       240
     IPSTGKVVYW ETVSSAASLG LSRQKQNGIQ GSTPGMLSGE YATDILNGEP SGIIVTFSSG       300
     RVAHITLRDP QGKPSVLVNF LRSTAGTGGG GIFGGLKNVF AGGSWRKEVT AVRAGGSHQR       360
     GQRDVIIATS TGLVEIWDTH WNHGNTLKKR YDLKEEILAA LPEYHAQPTN DTELKVADFA       420
     FSTLQSSDDA VQLSDGSWRL FLVVRSPQWL ETRALFVAQV HLSGNESRVM STHAVDLRHI       480
     PASQLETSKP KIFVPKPEET AFILIGQSLV ILSLTSVEES PSSQLLLDSN KLPLPFQDTI       540
     HLRSGTDHEI LGSMSEDQSN DSPCAACVLM LRNFGVIRVT VLPRPGIEQD VDEPQVTAKH       600
     KLEQAVFFGT MAKNPLNLSS EGDLNFPPSE MEQASLEICR ELLQSETRFI PTTAISLEQN       660
     LRLRAKALDD LASLLSRQGN PVSRPARWEL LWAAEKIAAQ RAMWKVQEAC KIKNGEEGPF       720
     LSHVIASMHD KFKTPINPQQ GETDPVRQWF LRDSYRMEHI IPWIKNAIKL GRSNTSNPAR       780
     ALSEKILAAS ELFLAVTETA FRYRDEHVAL YGLRGDFLED GVLSDGYEDL PEFWTSRGVG       840
     YSEAGHLLDL ELDSCRSWKT PASAADAPDT HVLNQVAKNS YRHLRVIGQM HLERTRWLSA       900
     QGDPKLMDES VSIEQAHVED RKWQLFKLAG IDHLADAVEL AESFRDMGAL VELIIELQDQ       960
     KATQHPQPPS DVSTNQTDID ADQLIAKYFD KFGDIWADAY FSRQIAMGYP GTLFTMRKYQ      1020
     SAVTRFLRSN PAYSRLSWIN DVIGEDDYDT AATSLEDLAI GSEKDLWSHR VEISLAKLGK      1080
     LATKERMDSP VVASTLQEDV KRLDDYVEVD GIQDILYSHI QPILQGAIDR KAELELVLDQ      1140
     CGEHIFEDRP SLHEILSDAL FTLIERQVVG ADGLIDILTL MGPAQLADDT EGELVRSEFH      1200
     LALQVLDYGR YGQRDPSYLT ALRRLIWRRC LIKDDWVARG KAAEGPNGNA SNLVADTTLY      1260
     RSLTACLEGD FVPNINTWTI ELTSVPCLEP RNAGLHSLYT PLSPAEALMT DSDSDILVSR      1320
     FRPEQKSRVA SDLQTENDIL RQCIEVGKLD FWFQNLRETA EVHISPPE                   1368
//

If you have problems or comments...

PBIL Back to PBIL home page