(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE420

PENCW_16.PE420       Location/Qualifiers
FT   CDS             956092..957474
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076720" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978097"
FT                   /orf_name="Pc20g04200"
FT                   /product="Pc20g04200 protein"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85749.1"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR021858"
FT                   /db_xref="UniParc:UPI00018314A6"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDA4"
FT                   /transl_table=1
FT                   /translation="MPPKRERTVQGSCWPCKQRRVKCDLGKPLCQRCISSGAKCCYDKL
FT                   LIRWKKTPSKTQSLTMSESPIMSLNIHLKDNNLAAGDLKALEYFQFALWPLFTTSAHPC
FT                   PPPIPLAMECQPVLLAVCELAEAHRTLRDEAGSSTVSAPFDKRMSCLASVREQLRNNPN
FT                   HTSLSPLLVAVFLLYFLDGFIECDRQSASTASHHVGVQAIVDHLGGFSALIKIGQKDIT
FT                   MLLSEFASTDLTKALLDDRPPCFPAEIWTQIEHGTVWWDQETYNGTTLASVFRIMSEMS
FT                   LYRQKIRGDPETLSMEVVRGFERCLQPSYQILDFDHLENPSTYTAHESTLERRMQADSF
FT                   TRAFQHSALVYLYRAICGLPPRHSLVQQHVQSCVECIRNISPLSKAHNCIIFPLYIMGA
FT                   HTFLQDQQAFVLERLDSIYKYLRFNCVLLVRAALVDLWESPRHDGDWWGMFTSLDEHVL
FT                   VI"
     MPPKRERTVQ GSCWPCKQRR VKCDLGKPLC QRCISSGAKC CYDKLLIRWK KTPSKTQSLT        60
     MSESPIMSLN IHLKDNNLAA GDLKALEYFQ FALWPLFTTS AHPCPPPIPL AMECQPVLLA       120
     VCELAEAHRT LRDEAGSSTV SAPFDKRMSC LASVREQLRN NPNHTSLSPL LVAVFLLYFL       180
     DGFIECDRQS ASTASHHVGV QAIVDHLGGF SALIKIGQKD ITMLLSEFAS TDLTKALLDD       240
     RPPCFPAEIW TQIEHGTVWW DQETYNGTTL ASVFRIMSEM SLYRQKIRGD PETLSMEVVR       300
     GFERCLQPSY QILDFDHLEN PSTYTAHEST LERRMQADSF TRAFQHSALV YLYRAICGLP       360
     PRHSLVQQHV QSCVECIRNI SPLSKAHNCI IFPLYIMGAH TFLQDQQAFV LERLDSIYKY       420
     LRFNCVLLVR AALVDLWESP RHDGDWWGMF TSLDEHVLVI                             460
//

If you have problems or comments...

PBIL Back to PBIL home page