(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE422

PENCW_16.PE422       Location/Qualifiers
FT   CDS             join(961036..961168,961217..961314,961360..>961443)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949941"
FT                   /orf_name="Pc20g04220"
FT                   /product="Pc20g04220 protein"
FT                   /protein_id="CAP85751.1"
FT                   /db_xref="UniParc:UPI00018314A8"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH1"
FT                   /transl_table=1
FT                   /translation="MAPSLVTIDSSEPLEKIIKVIERDGGVIVSNFLSPELLKECMDAI
FT                   EPFFQGRNTYDSRATHEELGPDFFPEGSQRVYALLAKIPDQLTKIVRLPVWQGIMAQFL
FT                   K"
     MAPSLVTIDS SEPLEKIIKV IERDGGVIVS NFLSPELLKE CMDAIEPFFQ GRNTYDSRAT        60
     HEELGPDFFP EGSQRVYALL AKIPDQLTKI VRLPVWQGIM AQFLK                       105
//

If you have problems or comments...

PBIL Back to PBIL home page