(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE424

PENCW_16.PE424       Location/Qualifiers
FT   CDS             963405..963842
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949942"
FT                   /orf_name="Pc20g04240"
FT                   /product="Pc20g04240 protein"
FT                   /protein_id="CAP85753.1"
FT                   /db_xref="UniParc:UPI00018314A9"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH2"
FT                   /transl_table=1
FT                   /translation="MTSDSRPCLEAWTCGGEIEDALSHRSSMSEHNWTLALFQKKDSKP
FT                   GSIVRAMRYMPLATPPRPNTTTAIICTSLFHMRWSSRLLFVLQDKLRHGSQVSRMRTRR
FT                   TRSEGCSLLCLILRFHVSCIRVCLDILEHTDTPRERLLPSK"
     MTSDSRPCLE AWTCGGEIED ALSHRSSMSE HNWTLALFQK KDSKPGSIVR AMRYMPLATP        60
     PRPNTTTAII CTSLFHMRWS SRLLFVLQDK LRHGSQVSRM RTRRTRSEGC SLLCLILRFH       120
     VSCIRVCLDI LEHTDTPRER LLPSK                                             145
//

If you have problems or comments...

PBIL Back to PBIL home page