(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE425

PENCW_16.PE425       Location/Qualifiers
FT   CDS             join(complement(964884..965174),complement(964239..964832))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196131" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672205"
FT                   /orf_name="Pc20g04250"
FT                   /product="Pc20g04250 protein"
FT                   /protein_id="CAP85754.1"
FT                   /db_xref="InterPro:IPR009737"
FT                   /db_xref="InterPro:IPR012335"
FT                   /db_xref="InterPro:IPR012336"
FT                   /db_xref="UniParc:UPI0001831585"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH3"
FT                   /transl_table=1
FT                   /translation="MLRSLLSFGRTGTNDYLFPKVDPKEDGPECLKDCADCTVKFPSKV
FT                   KVETSRPLYGQIKEFHSHVLVATGKSDWKEKHVEKMTGSLMEAFDEAESDHGVIKVSAS
FT                   NLTPPEQPTTDEGSNQATTVLILPSFTYVDSVTQADVPNLVAKFIDHPTNQQNGNETTS
FT                   PASGMSARPCELDYVILLCSHGRRDARCGITAPLIKRELERHLRPLGLNRDADDSRAGG
FT                   VGIFFVSHVGGHKFSANVLIYRKKDQQMIWLARVRPEHCEGIVKYTVLQGKVVHPESQL
FT                   RGGFDRLKELTSW"
     MLRSLLSFGR TGTNDYLFPK VDPKEDGPEC LKDCADCTVK FPSKVKVETS RPLYGQIKEF        60
     HSHVLVATGK SDWKEKHVEK MTGSLMEAFD EAESDHGVIK VSASNLTPPE QPTTDEGSNQ       120
     ATTVLILPSF TYVDSVTQAD VPNLVAKFID HPTNQQNGNE TTSPASGMSA RPCELDYVIL       180
     LCSHGRRDAR CGITAPLIKR ELERHLRPLG LNRDADDSRA GGVGIFFVSH VGGHKFSANV       240
     LIYRKKDQQM IWLARVRPEH CEGIVKYTVL QGKVVHPESQ LRGGFDRLKE LTSW             294
//

If you have problems or comments...

PBIL Back to PBIL home page