(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE426

PENCW_16.PE426       Location/Qualifiers
FT   CDS             join(966267..966335,966418..966734,966846..967146,
FT                   967218..968496,968555..968967,969026..969100)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196142" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949943"
FT                   /orf_name="Pc20g04260"
FT                   /product="Pc20g04260 protein"
FT                   /function="DNA binding"
FT                   /function="sequence-specific DNA binding transcription
FT                   factor activity"
FT                   /function="zinc ion binding"
FT                   /biological_process="regulation of transcription, DNA-
FT                   dependent"
FT                   /cellular_component="nucleus"
FT                   /protein_id="CAP85755.1"
FT                   /db_xref="GO:0003677"
FT                   /db_xref="GO:0003700"
FT                   /db_xref="GO:0005634"
FT                   /db_xref="GO:0006355"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR001138"
FT                   /db_xref="InterPro:IPR007219"
FT                   /db_xref="UniParc:UPI0001831586"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH4"
FT                   /transl_table=1
FT                   /translation="MKEKKERKDFGQTFHFGSHERDHLVSNECMDVQGNAQPERVRKRR
FT                   RRTMACTQCRTRKLRCDREYPTCSRCLKSRTPSKCTYEDGFLWQQPTTVPTTAFAADRG
FT                   SALSMPRDTPIETPPDSGIPPVSTRRPHDKERKDCFLETVLGAPKAAVNQEPYVNVGVL
FT                   QRPKRPAPAERETQAPSQTDDEHIDEEEDPLSPTDHLDLAPRIMMRGRETQTRFSGSGI
FT                   FANLVAQFPDIKYFAEEIKLSTPIFAQLQPDLRRVKRGLLKHMVLSRPFPDPTTASLIS
FT                   MLPSRGVVDELVGLYITHIESTHRILHVPSFLRELDQFWAMRDSPASISAGFTVQVLLV
FT                   LACAWNLADFASLQSKSSGELKCQSAVEWTLHAGKWIENLHTKRPEITSMRLSILLILA
FT                   RNAHGMRRSQAWLTTSTLVKQAMMAGYHRDPSRYARISVFNKEMRRRLWTTIVELDLQV
FT                   ALDRGMPPSVQSFDYDAAPGMNIYDDEIHENSTEVPESRPLSEVTDSSFQSILSRSLPL
FT                   RLQACSLMHSPRISCRYEDIQRLDSELNRHLSRIPAWVAPDPNDIVAQRKVMLWKGLIE
FT                   TKLCQSLLSVHTPFAIQARRESLFAPSTRTRLDAATRILSTQRRLHEISRTLSLCMLGE
FT                   WTIQAYISICQVLHTTEFDTSPPSYPTSSTFILHNIPGIPESLISLVETALIALEERSL
FT                   LMTKGAKDYYFLSTIVALVKSRLWPAQAAMYKQQVVERVLSFAQILFSRHMHCDHLGDK
FT                   GMGNFKNNQVAAFMAAPTMAPVMQPEFDPNGMHPPQPGAIPPGEFDPFLEIFDWEDLTS
FT                   MTFPC"
     MKEKKERKDF GQTFHFGSHE RDHLVSNECM DVQGNAQPER VRKRRRRTMA CTQCRTRKLR        60
     CDREYPTCSR CLKSRTPSKC TYEDGFLWQQ PTTVPTTAFA ADRGSALSMP RDTPIETPPD       120
     SGIPPVSTRR PHDKERKDCF LETVLGAPKA AVNQEPYVNV GVLQRPKRPA PAERETQAPS       180
     QTDDEHIDEE EDPLSPTDHL DLAPRIMMRG RETQTRFSGS GIFANLVAQF PDIKYFAEEI       240
     KLSTPIFAQL QPDLRRVKRG LLKHMVLSRP FPDPTTASLI SMLPSRGVVD ELVGLYITHI       300
     ESTHRILHVP SFLRELDQFW AMRDSPASIS AGFTVQVLLV LACAWNLADF ASLQSKSSGE       360
     LKCQSAVEWT LHAGKWIENL HTKRPEITSM RLSILLILAR NAHGMRRSQA WLTTSTLVKQ       420
     AMMAGYHRDP SRYARISVFN KEMRRRLWTT IVELDLQVAL DRGMPPSVQS FDYDAAPGMN       480
     IYDDEIHENS TEVPESRPLS EVTDSSFQSI LSRSLPLRLQ ACSLMHSPRI SCRYEDIQRL       540
     DSELNRHLSR IPAWVAPDPN DIVAQRKVML WKGLIETKLC QSLLSVHTPF AIQARRESLF       600
     APSTRTRLDA ATRILSTQRR LHEISRTLSL CMLGEWTIQA YISICQVLHT TEFDTSPPSY       660
     PTSSTFILHN IPGIPESLIS LVETALIALE ERSLLMTKGA KDYYFLSTIV ALVKSRLWPA       720
     QAAMYKQQVV ERVLSFAQIL FSRHMHCDHL GDKGMGNFKN NQVAAFMAAP TMAPVMQPEF       780
     DPNGMHPPQP GAIPPGEFDP FLEIFDWEDL TSMTFPC                                817
//

If you have problems or comments...

PBIL Back to PBIL home page