(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE427

PENCW_16.PE427       Location/Qualifiers
FT   CDS             join(970066..971067,971129..971261,971314..971339)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000292006" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949944"
FT                   /orf_name="Pc20g04270"
FT                   /product="Pc20g04270 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85756.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR006710"
FT                   /db_xref="InterPro:IPR016840"
FT                   /db_xref="UniParc:UPI0001831587"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH5"
FT                   /transl_table=1
FT                   /translation="MHHLLLLSIIIAIATPLGAIPSQSGAQSAKQVYQTTKKFPLANPG
FT                   NIPVHDPNIILHNEQYYLFKGGVNIPIFKSANVSGPWEKLGTVLAGDSIIPKTNRTRPW
FT                   APTTIEKDGTFYCYYTVSAKGSRDSAIGVATTTSLDGSPWTDHGVLINTGTGAGSGVWP
FT                   YTITNAIDASVVFDRDSGQAYLNYGSFWHDIWQVPLEDDLLSVRDGEAPDAVQLTFIPR
FT                   AKTKPEEGVWVSFRDGFYYAWFSHGNCCNFKNGFPGRGKEYSIRVGRSRSVRGPFEDKT
FT                   GKSLLEGGGTVVYGSNHGAVYAPGGLGVLPGNNDSMDILYYHYLNTSGGFKHGEAQLGW
FT                   NYLKYEDGWPVPVEGTNATANNAFGYGPPGWGYLAIMSGLWLCIWQ"
     MHHLLLLSII IAIATPLGAI PSQSGAQSAK QVYQTTKKFP LANPGNIPVH DPNIILHNEQ        60
     YYLFKGGVNI PIFKSANVSG PWEKLGTVLA GDSIIPKTNR TRPWAPTTIE KDGTFYCYYT       120
     VSAKGSRDSA IGVATTTSLD GSPWTDHGVL INTGTGAGSG VWPYTITNAI DASVVFDRDS       180
     GQAYLNYGSF WHDIWQVPLE DDLLSVRDGE APDAVQLTFI PRAKTKPEEG VWVSFRDGFY       240
     YAWFSHGNCC NFKNGFPGRG KEYSIRVGRS RSVRGPFEDK TGKSLLEGGG TVVYGSNHGA       300
     VYAPGGLGVL PGNNDSMDIL YYHYLNTSGG FKHGEAQLGW NYLKYEDGWP VPVEGTNATA       360
     NNAFGYGPPG WGYLAIMSGL WLCIWQ                                            386
//

If you have problems or comments...

PBIL Back to PBIL home page