(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE428

PENCW_16.PE428       Location/Qualifiers
FT   CDS             join(complement(971812..972395),complement(971564..971750))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_id="IGI15949945"
FT                   /orf_name="Pc20g04280"
FT                   /product="Pc20g04280 protein"
FT                   /function="binding"
FT                   /function="oxidoreductase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85757.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR002198"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR016040"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="UniParc:UPI0001831588"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH6"
FT                   /transl_table=1
FT                   /translation="MDSVKGKVYAVTGLGGIGLAVARQLHSQGALLSLADLSEKVLSTA
FT                   RQTIEVEFGSATASTITTTVLDISNVSAVQDWIADTVSHFGRLDGAANMAGTIGKKHGT
FT                   GKFVDQDDAEWDMLMRVNVTGLMYCLRAQLRAIMETAPGGKGSIVNASSIQGIKGFALH
FT                   AAYSTTKHAVSGLTKSVSKEVGPEIRVNAVAPGSIQTPLLDMATEIQGGFTMPPVSIPR
FT                   VGTGEEVAQTVVFLLSDASSYTTGQIVSVDGGWE"
     MDSVKGKVYA VTGLGGIGLA VARQLHSQGA LLSLADLSEK VLSTARQTIE VEFGSATAST        60
     ITTTVLDISN VSAVQDWIAD TVSHFGRLDG AANMAGTIGK KHGTGKFVDQ DDAEWDMLMR       120
     VNVTGLMYCL RAQLRAIMET APGGKGSIVN ASSIQGIKGF ALHAAYSTTK HAVSGLTKSV       180
     SKEVGPEIRV NAVAPGSIQT PLLDMATEIQ GGFTMPPVSI PRVGTGEEVA QTVVFLLSDA       240
     SSYTTGQIVS VDGGWE                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page