(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE429

PENCW_16.PE429       Location/Qualifiers
FT   CDS             complement(973071..973454)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000076619" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949946"
FT                   /orf_name="Pc20g04290"
FT                   /product="Putative uncharacterized protein Pc20g04290 "
FT                   /protein_id="CAP85758.1"
FT                   /db_xref="UniParc:UPI0001831589"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH7"
FT                   /transl_table=1
FT                   /translation="MTSPINTNFTQPAECYNSRDAVPASMPSNIQYYNQVPLYQTKSPN
FT                   RDMKAVLQSCCSNGVWIYEDPDPCTAVCDSRSSAEAKKTMYCLNAQMVVYGTKTEKSSA
FT                   TVRRPMGWVSLMVGGLLLSGMFI"
     MTSPINTNFT QPAECYNSRD AVPASMPSNI QYYNQVPLYQ TKSPNRDMKA VLQSCCSNGV        60
     WIYEDPDPCT AVCDSRSSAE AKKTMYCLNA QMVVYGTKTE KSSATVRRPM GWVSLMVGGL       120
     LLSGMFI                                                                 127
//

If you have problems or comments...

PBIL Back to PBIL home page