(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE43

PENCW_16.PE43        Location/Qualifiers
FT   CDS             join(complement(99409..99541),complement(99147..99297),
FT                   complement(98838..99087))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000048507" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946688"
FT                   /orf_name="Pc20g00430"
FT                   /product="Pc20g00430 protein"
FT                   /protein_id="CAP85372.1"
FT                   /db_xref="UniParc:UPI00018319E2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFD9"
FT                   /transl_table=1
FT                   /translation="MRSRVLPPLDCMIPSPVSFCFSSFHLFWDTIHHLPSHQTSTLTPM
FT                   TRSHKSNDREHQAEGMMGTRENIPRYFAKSGPTDADPRKTKKDGGGKGNWGRSGEEMQD
FT                   TDYSFANARRRSNSSTQGLADFNTKFEAFEPEPVFEEEAFDGADMTAGNDNTVTKVESA
FT                   SSNGSQADHVGRKY"
     MRSRVLPPLD CMIPSPVSFC FSSFHLFWDT IHHLPSHQTS TLTPMTRSHK SNDREHQAEG        60
     MMGTRENIPR YFAKSGPTDA DPRKTKKDGG GKGNWGRSGE EMQDTDYSFA NARRRSNSST       120
     QGLADFNTKF EAFEPEPVFE EEAFDGADMT AGNDNTVTKV ESASSNGSQA DHVGRKY          177
//

If you have problems or comments...

PBIL Back to PBIL home page