(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE430

PENCW_16.PE430       Location/Qualifiers
FT   CDS             join(complement(975449..975582),complement(974811..975402),
FT                   complement(974389..974760),complement(974000..974329))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196166" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949947"
FT                   /orf_name="Pc20g04300"
FT                   /product="Pc20g04300 protein"
FT                   /function="NADP+ or NADPH binding"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="flavin-containing monooxygenase activity "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85759.1"
FT                   /db_xref="GO:0004499"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0050661"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR020946"
FT                   /db_xref="UniParc:UPI000183158A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH8"
FT                   /transl_table=1
FT                   /translation="MPQIKSIAIIGAGPAGAIAVDALAQEKTFDVIRVFERQEKAGGCW
FT                   VSRDDEPPQELDFDGLSARTADAPLEIPEHLPCRMPVVSQDRFMDSPVYPALETNVNAA
FT                   AMSFSQEEIPVVRSQWSIERHGEDTPFRHHSVIRKYIEDLFNRRGYQDLVQYNTTVERA
FT                   IKDPNSQKWVLTFRRTEVVDGVKSDYWWSEEYDAVVVASGHYAVPFIPAIPGLKEFAAR
FT                   YPGSVQHTKHYRGPEKYRGKKVITVGASVSAADTAVSLVDSAQTPVVAVVRGRYNAYFG
FT                   DLAFQHPKIQRRPPISHITSNDQGERTVHFEDGTSETGVDHVIFGTGFSWTLPFLPQVP
FT                   TRNNRVPDLYQHVFYRHDPSLVFVGAVGAGLTFKVFEWQAVAAARVLAGKANLPSIAEQ
FT                   EKWETDRIAQKSDGPGFTVLNPEFEPYFESLRQLAGEPRGTGRRLPRFEQKWLSDFDEG
FT                   HERRKKMWRRANQTARL"
     MPQIKSIAII GAGPAGAIAV DALAQEKTFD VIRVFERQEK AGGCWVSRDD EPPQELDFDG        60
     LSARTADAPL EIPEHLPCRM PVVSQDRFMD SPVYPALETN VNAAAMSFSQ EEIPVVRSQW       120
     SIERHGEDTP FRHHSVIRKY IEDLFNRRGY QDLVQYNTTV ERAIKDPNSQ KWVLTFRRTE       180
     VVDGVKSDYW WSEEYDAVVV ASGHYAVPFI PAIPGLKEFA ARYPGSVQHT KHYRGPEKYR       240
     GKKVITVGAS VSAADTAVSL VDSAQTPVVA VVRGRYNAYF GDLAFQHPKI QRRPPISHIT       300
     SNDQGERTVH FEDGTSETGV DHVIFGTGFS WTLPFLPQVP TRNNRVPDLY QHVFYRHDPS       360
     LVFVGAVGAG LTFKVFEWQA VAAARVLAGK ANLPSIAEQE KWETDRIAQK SDGPGFTVLN       420
     PEFEPYFESL RQLAGEPRGT GRRLPRFEQK WLSDFDEGHE RRKKMWRRAN QTARL            475
//

If you have problems or comments...

PBIL Back to PBIL home page