(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE431

PENCW_16.PE431       Location/Qualifiers
FT   CDS             join(complement(979669..979789),complement(979342..979587),
FT                   complement(978819..979259),complement(976211..978762))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000093545" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129262"
FT                   /orf_name="Pc20g04310"
FT                   /product="Pc20g04310 protein"
FT                   /function="FMN binding"
FT                   /function="electron carrier activity"
FT                   /function="heme binding"
FT                   /function="monooxygenase activity"
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85760.1"
FT                   /db_xref="GO:0004497"
FT                   /db_xref="GO:0009055"
FT                   /db_xref="GO:0010181"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001128"
FT                   /db_xref="InterPro:IPR001433"
FT                   /db_xref="InterPro:IPR002401"
FT                   /db_xref="InterPro:IPR003097"
FT                   /db_xref="InterPro:IPR008254"
FT                   /db_xref="InterPro:IPR015702"
FT                   /db_xref="InterPro:IPR017927"
FT                   /db_xref="InterPro:IPR017938"
FT                   /db_xref="InterPro:IPR017972"
FT                   /db_xref="InterPro:IPR023173"
FT                   /db_xref="InterPro:IPR023206"
FT                   /db_xref="UniParc:UPI000183158B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDH9"
FT                   /transl_table=1
FT                   /translation="MSSTDQVPIPGPKGVPFLGNVYDIEPELPLQSFERMADSYGPIYR
FT                   LTTFGRARVFVSSHELVDEVCDEERFSKMVSAGLAEIRNGVHDGLFTANYPGEENWAIA
FT                   HRILVPAFGPLMIRGMFDEMYDIATQLVMKWARIGPAAPIQVTDDFTRLTLDTIALCAM
FT                   GTRFNSFYHDEMHPFVEAMVGLLSVSGHRALKPALLNNLPTSENNKYWSDIEYLRNLSK
FT                   ELVDSRKENPVDKKDLLNALILGRDPQTGRGMTDDSIVDNMITFLIAGHETTSGMLSFL
FT                   FYHLLKNPSAYRKAQDEVDRVIGKRKITVDDMSKLPYITAVMRETLRLNPTAPMIALHP
FT                   HPTKNKEDPVTLGGGKYVLNGDETIALLLTKMHRDPKVYGPDADEFKPERMLDENFEKL
FT                   PKNAWKPFGNGMRGCIGRPFAWQEALLVVAILLQNFNFQMENPSYDLRLKQTLTIKPKD
FT                   FHMKATLRDGLDPTQLSTTLSGSGAGPTETGAASRDRKPKVAPAGGKLKPMHVFYGSNT
FT                   GTCEAFARRLADDAAAYGYAAQTNSLDSAMQNIPKNDPVVFISASYEGQPPDNAAHFFQ
FT                   WLSELKGSELEGVNYAVFGCGHHDWSSTFYRVPKAIDELAKTNGANKLCDIGLADAANS
FT                   DMFTDFDGWGETLFWPGVMAKFGGTSPEPAAKPKSSLQVEVSSGMRASTLGLQLEEGFV
FT                   IENQLLTPPGAPAKRVVKFKLPSDMTYQCGDYLAVLPVNPSPVVRRAIRRFDLPWDAVL
FT                   KVKKPSGSTSSPSIPIDTPISAFELLSTYIELSQPASKRDLNVLADAAISDAELQAELR
FT                   YLASSPSRFTEEIVKKRVSPLDLLIRYPSIKLLIGDFLAMLPPMRVRQYSISSSPLVDP
FT                   SECSITFTVLSAPALANATPEGSESIEQYLGVASNYLSELQAGERAHITVRPSHSGFKP
FT                   PMDLETPMIMACAGSGLAPFRGFVMDRAEKIRGRRSSPDSDELHESETFKPAKAVLYIG
FT                   CRTKGQDDIHAAELAEWAALGAVDVRWAYSRPADGSKGQHVQDAMLDDREELVKLFDEG
FT                   ANIYVCGSTGVGAGIRDACKQMYLERRRAVHAELREKGETPPGADLEEDQAAEQFFDNL
FT                   RTKERYATDVFT"
     MSSTDQVPIP GPKGVPFLGN VYDIEPELPL QSFERMADSY GPIYRLTTFG RARVFVSSHE        60
     LVDEVCDEER FSKMVSAGLA EIRNGVHDGL FTANYPGEEN WAIAHRILVP AFGPLMIRGM       120
     FDEMYDIATQ LVMKWARIGP AAPIQVTDDF TRLTLDTIAL CAMGTRFNSF YHDEMHPFVE       180
     AMVGLLSVSG HRALKPALLN NLPTSENNKY WSDIEYLRNL SKELVDSRKE NPVDKKDLLN       240
     ALILGRDPQT GRGMTDDSIV DNMITFLIAG HETTSGMLSF LFYHLLKNPS AYRKAQDEVD       300
     RVIGKRKITV DDMSKLPYIT AVMRETLRLN PTAPMIALHP HPTKNKEDPV TLGGGKYVLN       360
     GDETIALLLT KMHRDPKVYG PDADEFKPER MLDENFEKLP KNAWKPFGNG MRGCIGRPFA       420
     WQEALLVVAI LLQNFNFQME NPSYDLRLKQ TLTIKPKDFH MKATLRDGLD PTQLSTTLSG       480
     SGAGPTETGA ASRDRKPKVA PAGGKLKPMH VFYGSNTGTC EAFARRLADD AAAYGYAAQT       540
     NSLDSAMQNI PKNDPVVFIS ASYEGQPPDN AAHFFQWLSE LKGSELEGVN YAVFGCGHHD       600
     WSSTFYRVPK AIDELAKTNG ANKLCDIGLA DAANSDMFTD FDGWGETLFW PGVMAKFGGT       660
     SPEPAAKPKS SLQVEVSSGM RASTLGLQLE EGFVIENQLL TPPGAPAKRV VKFKLPSDMT       720
     YQCGDYLAVL PVNPSPVVRR AIRRFDLPWD AVLKVKKPSG STSSPSIPID TPISAFELLS       780
     TYIELSQPAS KRDLNVLADA AISDAELQAE LRYLASSPSR FTEEIVKKRV SPLDLLIRYP       840
     SIKLLIGDFL AMLPPMRVRQ YSISSSPLVD PSECSITFTV LSAPALANAT PEGSESIEQY       900
     LGVASNYLSE LQAGERAHIT VRPSHSGFKP PMDLETPMIM ACAGSGLAPF RGFVMDRAEK       960
     IRGRRSSPDS DELHESETFK PAKAVLYIGC RTKGQDDIHA AELAEWAALG AVDVRWAYSR      1020
     PADGSKGQHV QDAMLDDREE LVKLFDEGAN IYVCGSTGVG AGIRDACKQM YLERRRAVHA      1080
     ELREKGETPP GADLEEDQAA EQFFDNLRTK ERYATDVFT                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page