(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE432

PENCW_16.PE432       Location/Qualifiers
FT   CDS             join(complement(981315..982114),complement(980961..981261))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000196187" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949948"
FT                   /orf_name="Pc20g04320"
FT                   /product="Pc20g04320 protein"
FT                   /function="hydrolase activity, hydrolyzing O-glycosyl
FT                   compounds"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85761.1"
FT                   /db_xref="GO:0004553"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="InterPro:IPR000757"
FT                   /db_xref="InterPro:IPR008985"
FT                   /db_xref="InterPro:IPR013320"
FT                   /db_xref="UniParc:UPI000183158C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI0"
FT                   /transl_table=1
FT                   /translation="MFFSRIAILAALAGYATAQTSTECDPTKEDCPPDPALGTEHTWNF
FT                   NTTLDEKIWNMTTGTYEYEDDGAKFTLQREGESTLLQSNFYIFFGVVEAHVKMATGKGL
FT                   VSSVVLESDDLDEIDWEWMGYNTSEVQSNFFGKGNDTTFDRGGHHHVANADTEFHNYTT
FT                   YWDQDKLQWWIDGEMVRELPYNDESALFGKNYPQTPCRVQFSLWPAGRKDAPQGTIDWA
FT                   GGLVDWDTAPFTMTLGKLRVKDFHSGKEYSYGDRSGSWESIEILEGNSTALNELNKPEP
FT                   KSLSEKWDDLGEGAHIGVYIGAGVAGAIAIAGFLFFCLRQRRKGRLENALGNNPVPLNR
FT                   AEMENFQKDWRQSEWKHNGGYQQVSN"
     MFFSRIAILA ALAGYATAQT STECDPTKED CPPDPALGTE HTWNFNTTLD EKIWNMTTGT        60
     YEYEDDGAKF TLQREGESTL LQSNFYIFFG VVEAHVKMAT GKGLVSSVVL ESDDLDEIDW       120
     EWMGYNTSEV QSNFFGKGND TTFDRGGHHH VANADTEFHN YTTYWDQDKL QWWIDGEMVR       180
     ELPYNDESAL FGKNYPQTPC RVQFSLWPAG RKDAPQGTID WAGGLVDWDT APFTMTLGKL       240
     RVKDFHSGKE YSYGDRSGSW ESIEILEGNS TALNELNKPE PKSLSEKWDD LGEGAHIGVY       300
     IGAGVAGAIA IAGFLFFCLR QRRKGRLENA LGNNPVPLNR AEMENFQKDW RQSEWKHNGG       360
     YQQVSN                                                                  366
//

If you have problems or comments...

PBIL Back to PBIL home page