(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE433

PENCW_16.PE433       Location/Qualifiers
FT   CDS             join(complement(984377..984379),complement(983874..984236))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000196188" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824905"
FT                   /orf_name="Pc20g04330"
FT                   /product="Pc20g04330 protein"
FT                   /protein_id="CAP85762.1"
FT                   /db_xref="UniParc:UPI000183158D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDI1"
FT                   /transl_table=1
FT                   /translation="MAPINSMLEPRQSSGDTCPSTISGGGIAGIVIGSIAGTLLILWLW
FT                   RIFRLPGAWSGGDTSDVGYRPPITRSSTSSRGKRQRRRPSATYVDYVEKPTTVRSSRRY
FT                   RDHDDLRRPAKVYLSEP"
     MAPINSMLEP RQSSGDTCPS TISGGGIAGI VIGSIAGTLL ILWLWRIFRL PGAWSGGDTS        60
     DVGYRPPITR SSTSSRGKRQ RRRPSATYVD YVEKPTTVRS SRRYRDHDDL RRPAKVYLSE       120
     P                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page