(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE437

PENCW_16.PE437       Location/Qualifiers
FT   CDS             join(992643..992688,992738..992821,993109..993136,
FT                   993188..994640)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184796" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949951"
FT                   /orf_name="Pc20g04370"
FT                   /product="Pc20g04370 protein"
FT                   /function="nucleic acid binding"
FT                   /function="zinc ion binding"
FT                   /protein_id="CAP85766.1"
FT                   /db_xref="GO:0003676"
FT                   /db_xref="GO:0008270"
FT                   /db_xref="InterPro:IPR000571"
FT                   /db_xref="UniParc:UPI0001831591"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR4"
FT                   /transl_table=1
FT                   /translation="MVVCSFFQQGRCKFGDRCKFEHPGKPTAGASGNRFGALSGGFGGQ
FT                   NQTQEAVDPVVKATEIKQDLTAGQGRPEWIFSAYAPHRDVARQLFGGAHRERSMEEMRL
FT                   RHYELAASGNLNQAVQEASALWQECVQQMEISLNDLNGAVKYVIDGKDEHPNRHDIIEG
FT                   KTQTSMNQAPAPFGQQSPFGQQTAAPAPGAFGAPSSAFGQPSGLGQSVGFGRASAPAQP
FT                   TGMGQSTAFGQTSALGGSAFGQTSTLGGQPAFGKPAFGQPAVNPSPFGKPSVPGSGAPF
FT                   GAPSAASPFTQVAQNQPTAGGFGQPAAPSPFGQTAAQAAPSPFGQSAANPSPFGQPSAP
FT                   VGASPFGQPSAPAAPAAPAAPAASAPFGAPSAASPFAQVSQTQPAAGGFGQPAAQPAPS
FT                   PFGQPAVQGVPVQTANAGPRAYIKIENPQDLNPLPQLEGETRRNPSTKQLVMWKGRPVK
FT                   YINEHPCYLHPQDNKTFVRINFPNGPPDAASLKDAHGKPEEYTPEIVEAYEFFLQYGYF
FT                   KDGNIPAVPPKQEWLSFDF"
     MVVCSFFQQG RCKFGDRCKF EHPGKPTAGA SGNRFGALSG GFGGQNQTQE AVDPVVKATE        60
     IKQDLTAGQG RPEWIFSAYA PHRDVARQLF GGAHRERSME EMRLRHYELA ASGNLNQAVQ       120
     EASALWQECV QQMEISLNDL NGAVKYVIDG KDEHPNRHDI IEGKTQTSMN QAPAPFGQQS       180
     PFGQQTAAPA PGAFGAPSSA FGQPSGLGQS VGFGRASAPA QPTGMGQSTA FGQTSALGGS       240
     AFGQTSTLGG QPAFGKPAFG QPAVNPSPFG KPSVPGSGAP FGAPSAASPF TQVAQNQPTA       300
     GGFGQPAAPS PFGQTAAQAA PSPFGQSAAN PSPFGQPSAP VGASPFGQPS APAAPAAPAA       360
     PAASAPFGAP SAASPFAQVS QTQPAAGGFG QPAAQPAPSP FGQPAVQGVP VQTANAGPRA       420
     YIKIENPQDL NPLPQLEGET RRNPSTKQLV MWKGRPVKYI NEHPCYLHPQ DNKTFVRINF       480
     PNGPPDAASL KDAHGKPEEY TPEIVEAYEF FLQYGYFKDG NIPAVPPKQE WLSFDF           536
//

If you have problems or comments...

PBIL Back to PBIL home page