(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE438

PENCW_16.PE438       Location/Qualifiers
FT   CDS             join(complement(995591..995632),complement(995232..995455),
FT                   complement(995067..995151))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000270245" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949952"
FT                   /orf_name="Pc20g04380"
FT                   /product="Pc20g04380 protein"
FT                   /function="RNA binding"
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="small ribosomal subunit"
FT                   /protein_id="CAP85767.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="GO:0015935"
FT                   /db_xref="InterPro:IPR001848"
FT                   /db_xref="InterPro:IPR005729"
FT                   /db_xref="InterPro:IPR018268"
FT                   /db_xref="UniParc:UPI0001831592"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR5"
FT                   /transl_table=1
FT                   /translation="MSFQKPEKDFGEGPKVHKIRITLTSRKVASLEKVCQELIDRARSK
FT                   SLQVKGPVRLPTKTLQISTRKTPNGEGSKTWDKYEMRIHKRLIDLLAPTETVKQIIINI
FT                   EAGVEVEVTIAA"
     MSFQKPEKDF GEGPKVHKIR ITLTSRKVAS LEKVCQELID RARSKSLQVK GPVRLPTKTL        60
     QISTRKTPNG EGSKTWDKYE MRIHKRLIDL LAPTETVKQI IINIEAGVEV EVTIAA           116
//

If you have problems or comments...

PBIL Back to PBIL home page