(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE439

PENCW_16.PE439       Location/Qualifiers
FT   CDS             996038..998125
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184807" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672206"
FT                   /orf_name="Pc20g04390"
FT                   /product="Pc20g04390 protein"
FT                   /protein_id="CAP85768.1"
FT                   /db_xref="InterPro:IPR003892"
FT                   /db_xref="InterPro:IPR009060"
FT                   /db_xref="UniParc:UPI000183167C"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR6"
FT                   /transl_table=1
FT                   /translation="MAEFPPLAPVPSPAVRRTIPSNDWEACLDAWMALLGIRLNASDQQ
FT                   FKVAASEDASIPLFLGSYYQYTAAGDSSLQSGPKARQLRKLCFLAIRRYILDLTNPPDG
FT                   IMDWRLLGNLCCCHPASAALKTSLSSAWDMHQSKITSSLERAKATVIKNLSSANSSSNP
FT                   EVISDIRRLTILASVLPACGQELMAGSDFLDTISEAYQSKGARDEFRRILVANVYVGLI
FT                   SLLKEPVNLSSLLDQLFSLKAAARVGAPKMKKEPTLLSDLICSSDVLVRLEKYLSIHPQ
FT                   KRGQDLLASLRTYQVESKPLHHRYQRRKKVDKGKGVSSDPIVSGELHAHKMSLVTQVQD
FT                   LFPDLGSGFVVRLLDFYNDNPETIVTHLLDDSLPLELQSLDRSEQLPPPAEPHHSHLPP
FT                   QPTPPAMPSPTFAPLPTRKNIFDKDVDIAELSRSSEAQGKLHFGRADADQTADTLLAGH
FT                   GKHAANKAAILSALATFDSDDDERDDTYDAADVGGAIDGAAGGTDGEADAAQRDRRAAD
FT                   IETVLFRAYKSNPGLFARDSATRRSQPRASLKRETEMTDEAIEGWALMLTRDPKRIAKL
FT                   EDRLAMDAGGSAGAGPLNQPELRPTSYRRPQPREDGDEGSDEGDSSGHAGPRGGRGGGG
FT                   RGRGRGGGRGRGGRGGSGGQGQPDTAASRQRKEENKGSRANHNRRQQHAKKMARGGGLP
FT                   G"
     MAEFPPLAPV PSPAVRRTIP SNDWEACLDA WMALLGIRLN ASDQQFKVAA SEDASIPLFL        60
     GSYYQYTAAG DSSLQSGPKA RQLRKLCFLA IRRYILDLTN PPDGIMDWRL LGNLCCCHPA       120
     SAALKTSLSS AWDMHQSKIT SSLERAKATV IKNLSSANSS SNPEVISDIR RLTILASVLP       180
     ACGQELMAGS DFLDTISEAY QSKGARDEFR RILVANVYVG LISLLKEPVN LSSLLDQLFS       240
     LKAAARVGAP KMKKEPTLLS DLICSSDVLV RLEKYLSIHP QKRGQDLLAS LRTYQVESKP       300
     LHHRYQRRKK VDKGKGVSSD PIVSGELHAH KMSLVTQVQD LFPDLGSGFV VRLLDFYNDN       360
     PETIVTHLLD DSLPLELQSL DRSEQLPPPA EPHHSHLPPQ PTPPAMPSPT FAPLPTRKNI       420
     FDKDVDIAEL SRSSEAQGKL HFGRADADQT ADTLLAGHGK HAANKAAILS ALATFDSDDD       480
     ERDDTYDAAD VGGAIDGAAG GTDGEADAAQ RDRRAADIET VLFRAYKSNP GLFARDSATR       540
     RSQPRASLKR ETEMTDEAIE GWALMLTRDP KRIAKLEDRL AMDAGGSAGA GPLNQPELRP       600
     TSYRRPQPRE DGDEGSDEGD SSGHAGPRGG RGGGGRGRGR GGGRGRGGRG GSGGQGQPDT       660
     AASRQRKEEN KGSRANHNRR QQHAKKMARG GGLPG                                  695
//

If you have problems or comments...

PBIL Back to PBIL home page