(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE44

PENCW_16.PE44        Location/Qualifiers
FT   CDS             join(complement(102012..102025),complement(101819..101903),
FT                   complement(101741..101766),complement(101176..101677),
FT                   complement(100966..101109))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000105220" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824087"
FT                   /gene_name="rps1"
FT                   /orf_name="Pc20g00440"
FT                   /product="40S ribosomal protein S1 "
FT                   /function="structural constituent of ribosome"
FT                   /biological_process="translation"
FT                   /cellular_component="ribosome"
FT                   /protein_id="CAP85373.1"
FT                   /db_xref="GO:0003735"
FT                   /db_xref="GO:0005840"
FT                   /db_xref="GO:0006412"
FT                   /db_xref="InterPro:IPR001593"
FT                   /db_xref="InterPro:IPR018281"
FT                   /db_xref="UniParc:UPI00018319E3"
FT                   /db_xref="UniProtKB/Swiss-Prot:B6HFE0"
FT                   /transl_table=1
FT                   /translation="MAVGKNKRLSKGKKGIKKRTVDPFTRKDEYSVKAPSTFQTRDVGK
FT                   TLVNRTSGLKNANDSLKGRIFEVSLADLQNDEDHAFRKVKLRVDEIQGKNCLTNFHGLD
FT                   FTTDKLRSLVRKWQSLIEANITVKTTDDYLLRLFAIAFTKRRPNQIKKTTYARSSQIRA
FT                   IRKKMTEIIQREASTCTLSQLTHKLIPEVIGREIEKSTQGIYPLQNVHIRKVKLLKSPK
FT                   FDLGALLALHGESATDDKGQKVEREFKETVLESV"
     MAVGKNKRLS KGKKGIKKRT VDPFTRKDEY SVKAPSTFQT RDVGKTLVNR TSGLKNANDS        60
     LKGRIFEVSL ADLQNDEDHA FRKVKLRVDE IQGKNCLTNF HGLDFTTDKL RSLVRKWQSL       120
     IEANITVKTT DDYLLRLFAI AFTKRRPNQI KKTTYARSSQ IRAIRKKMTE IIQREASTCT       180
     LSQLTHKLIP EVIGREIEKS TQGIYPLQNV HIRKVKLLKS PKFDLGALLA LHGESATDDK       240
     GQKVEREFKE TVLESV                                                       256
//

If you have problems or comments...

PBIL Back to PBIL home page