(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE440

PENCW_16.PE440       Location/Qualifiers
FT   CDS             join(complement(999922..1000124),c
FT                   omplement(998393..999857))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000184828" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672207"
FT                   /orf_name="Pc20g04400"
FT                   /product="Pc20g04400 protein"
FT                   /EC_number="1.14.19.3"
FT                   /function="heme binding"
FT                   /function="linoleoyl-CoA desaturase activity"
FT                   /biological_process="fatty acid biosynthetic process "
FT                   /biological_process="oxidation-reduction process "
FT                   /protein_id="CAP85769.1"
FT                   /db_xref="GO:0006633"
FT                   /db_xref="GO:0016213"
FT                   /db_xref="GO:0020037"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001199"
FT                   /db_xref="InterPro:IPR005804"
FT                   /db_xref="InterPro:IPR012171"
FT                   /db_xref="InterPro:IPR018506"
FT                   /db_xref="UniParc:UPI000183167D"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR7"
FT                   /transl_table=1
FT                   /translation="MEKTASRPSRKDTLLTRRYIEGLIAEGKHVIIFEGRVLRVDPFIR
FT                   YHPGGEKPIKHMVGRDATDEINALHSEEARQRMHSYQIGRIEGTWINFLPPIQGGKFRA
FT                   YTEDTCSSDEDSTTPEIFSGSSQDGSIPPSPVFDAVDSKSTVRQRKPTGTTSTEQSQAK
FT                   PAFLDARTREEIVLDTAKYPSLDPASQEEIKRKYRELNERIKAEGLYDCNYSCYFVECC
FT                   RYTLFAGLSYTFLRMGWWATSAFFLGCFWHQLVFTAHDAGHMGITHNFHVDTVIGMFIA
FT                   DYLGGLSLGWWKRSHNVHHIVTNEPEHDPDIEHIPFFAISHRFLTSLRSTYYDRIMTFD
FT                   APARFLLKFQNYSYYPIMMLARFNLYVLSWEYLLKGQAPKRGPAWWHVWFELVGQVFFW
FT                   TWFGYGVMYKTLPDASSRIIFLLVSHIVSSPLHVQITLSHFAMSTADLGVGESFAQKML
FT                   RTTMDVDCPTWLDFFHGGLQFQAIHHLYPRIPRHNLRRTQKFVIEFCRDTGIPYAIFTF
FT                   YDGNKEVISRLGDVAKQVRLMEECRKSIAEDGVFSHHH"
     MEKTASRPSR KDTLLTRRYI EGLIAEGKHV IIFEGRVLRV DPFIRYHPGG EKPIKHMVGR        60
     DATDEINALH SEEARQRMHS YQIGRIEGTW INFLPPIQGG KFRAYTEDTC SSDEDSTTPE       120
     IFSGSSQDGS IPPSPVFDAV DSKSTVRQRK PTGTTSTEQS QAKPAFLDAR TREEIVLDTA       180
     KYPSLDPASQ EEIKRKYREL NERIKAEGLY DCNYSCYFVE CCRYTLFAGL SYTFLRMGWW       240
     ATSAFFLGCF WHQLVFTAHD AGHMGITHNF HVDTVIGMFI ADYLGGLSLG WWKRSHNVHH       300
     IVTNEPEHDP DIEHIPFFAI SHRFLTSLRS TYYDRIMTFD APARFLLKFQ NYSYYPIMML       360
     ARFNLYVLSW EYLLKGQAPK RGPAWWHVWF ELVGQVFFWT WFGYGVMYKT LPDASSRIIF       420
     LLVSHIVSSP LHVQITLSHF AMSTADLGVG ESFAQKMLRT TMDVDCPTWL DFFHGGLQFQ       480
     AIHHLYPRIP RHNLRRTQKF VIEFCRDTGI PYAIFTFYDG NKEVISRLGD VAKQVRLMEE       540
     CRKSIAEDGV FSHHH                                                        555
//

If you have problems or comments...

PBIL Back to PBIL home page