(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE441

PENCW_16.PE441       Location/Qualifiers
FT   CDS             join(1000393..1000398,1000452..1000496,1000551..1000629,
FT                   1000683..1001002,1001054..1001072,1001123..1001132,
FT                   1001184..1001364,1001414..1001703,1001759..1002435,
FT                   1002488..1002648)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000268676" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949953"
FT                   /orf_name="Pc20g04410"
FT                   /product="Pc20g04410 protein"
FT                   /function="intramolecular transferase activity,
FT                   phosphotransferases"
FT                   /function="magnesium ion binding"
FT                   /biological_process="carbohydrate metabolic process "
FT                   /protein_id="CAP85770.1"
FT                   /db_xref="GO:0000287"
FT                   /db_xref="GO:0005975"
FT                   /db_xref="GO:0016868"
FT                   /db_xref="InterPro:IPR005841"
FT                   /db_xref="InterPro:IPR005843"
FT                   /db_xref="InterPro:IPR005844"
FT                   /db_xref="InterPro:IPR005845"
FT                   /db_xref="InterPro:IPR005846"
FT                   /db_xref="InterPro:IPR016055"
FT                   /db_xref="InterPro:IPR016066"
FT                   /db_xref="UniParc:UPI000183167E"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR8"
FT                   /transl_table=1
FT                   /translation="MAQSITSLTEQWLQWDQDPTTRVEIEQLRDSKATEELEKRLRNRI
FT                   EFGTAGLRGRMAAGFSCMNSLIVIQASQGLAKFIRDKRSEIASNGVVIGHDARHNSAKL
FT                   AALAANAFIAQRIPVWFFNEEGPTPMVAFGVNYFGAAAGIMVTASHNPPQDNGYKVYSN
FT                   NGAQINRPEDGEIAQSIQENLEPWPTAWAELQPGEFLRADSYQKLLPHYSSQVAKYTKS
FT                   TVTDWQPPRPFVYTPLHGVGGLVLPNLCRSLGINEFSSVAAQEKPDPDFPTVKFPNPEE
FT                   AGALDLAIETADQEGKTLIVANDPDADRFAVAEKVDGKWHTLTGNHLGVLLASHVLDSF
FT                   DASKNWSHIAVLTTTVSSGMLGKMAAAKGIHFVETLTGFKWMANVARDLEKEGKTVPFA
FT                   YEEALGYMFPSVCYDKDGITAAAVFLAAEAKWRAQGMTAYAKLQQLFSEFGHHETLNNY
FT                   FRSPNPQLTSTLFQGIRGSPGLANMQFGRFKILRWRDLTEGYDSGTPDNKPDLPQDPTS
FT                   QMITMWLDGGVRFTFRGSGTEPKVKFYIESCGDSREDAVKAVCDAFLTIREEWVQRFTP
FT                   SMTYSKQLSTSSGDVLNVE"
     MAQSITSLTE QWLQWDQDPT TRVEIEQLRD SKATEELEKR LRNRIEFGTA GLRGRMAAGF        60
     SCMNSLIVIQ ASQGLAKFIR DKRSEIASNG VVIGHDARHN SAKLAALAAN AFIAQRIPVW       120
     FFNEEGPTPM VAFGVNYFGA AAGIMVTASH NPPQDNGYKV YSNNGAQINR PEDGEIAQSI       180
     QENLEPWPTA WAELQPGEFL RADSYQKLLP HYSSQVAKYT KSTVTDWQPP RPFVYTPLHG       240
     VGGLVLPNLC RSLGINEFSS VAAQEKPDPD FPTVKFPNPE EAGALDLAIE TADQEGKTLI       300
     VANDPDADRF AVAEKVDGKW HTLTGNHLGV LLASHVLDSF DASKNWSHIA VLTTTVSSGM       360
     LGKMAAAKGI HFVETLTGFK WMANVARDLE KEGKTVPFAY EEALGYMFPS VCYDKDGITA       420
     AAVFLAAEAK WRAQGMTAYA KLQQLFSEFG HHETLNNYFR SPNPQLTSTL FQGIRGSPGL       480
     ANMQFGRFKI LRWRDLTEGY DSGTPDNKPD LPQDPTSQMI TMWLDGGVRF TFRGSGTEPK       540
     VKFYIESCGD SREDAVKAVC DAFLTIREEW VQRFTPSMTY SKQLSTSSGD VLNVE            595
//

If you have problems or comments...

PBIL Back to PBIL home page