(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE443

PENCW_16.PE443       Location/Qualifiers
FT   CDS             complement(1006244..1007050)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000234813" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824906"
FT                   /orf_name="Pc20g04430"
FT                   /product="Pc20g04430 protein"
FT                   /function="ATP binding"
FT                   /function="protein kinase activity"
FT                   /biological_process="protein phosphorylation"
FT                   /protein_id="CAP85772.1"
FT                   /db_xref="GO:0004672"
FT                   /db_xref="GO:0005524"
FT                   /db_xref="GO:0006468"
FT                   /db_xref="InterPro:IPR000719"
FT                   /db_xref="InterPro:IPR011009"
FT                   /db_xref="InterPro:IPR017442"
FT                   /db_xref="UniParc:UPI000183167F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDR9"
FT                   /transl_table=1
FT                   /translation="MYILEYSEDFGGPEDDFAFQKTIIVYEMSGSIYRAYSRKRYATKE
FT                   DIQFGDMYSTNKIQGALVFPEFSDKFTKAEKSPDCSTWYLKKPSLSPYSPQYPALIRET
FT                   WIEEVKTCELLKKNPHPNIAEYHGCAVVDGGSIRGIYFTKYDETLMARVNTARRNKIDF
FT                   AYERQEADREEIDRWVEGVARGLKHLHGLGIVHNDINPCNIMFQGDTPVIIDFDSARPR
FT                   GHDLSLVKRTHGWHDGKTKVALPMNDIAALLEIQSWLLGEVDQFQF"
     MYILEYSEDF GGPEDDFAFQ KTIIVYEMSG SIYRAYSRKR YATKEDIQFG DMYSTNKIQG        60
     ALVFPEFSDK FTKAEKSPDC STWYLKKPSL SPYSPQYPAL IRETWIEEVK TCELLKKNPH       120
     PNIAEYHGCA VVDGGSIRGI YFTKYDETLM ARVNTARRNK IDFAYERQEA DREEIDRWVE       180
     GVARGLKHLH GLGIVHNDIN PCNIMFQGDT PVIIDFDSAR PRGHDLSLVK RTHGWHDGKT       240
     KVALPMNDIA ALLEIQSWLL GEVDQFQF                                          268
//

If you have problems or comments...

PBIL Back to PBIL home page