(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE444

PENCW_16.PE444       Location/Qualifiers
FT   CDS             join(1007315..1007544,1007604..1008128,1008385..1008475)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949954"
FT                   /orf_name="Pc20g04440"
FT                   /product="Putative uncharacterized protein Pc20g04440 "
FT                   /protein_id="CAP85773.1"
FT                   /db_xref="UniParc:UPI0001831680"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS0"
FT                   /transl_table=1
FT                   /translation="MHRIYREPKAKRDILLPHHHTSRQEADRYGHRNMCHVQQDTPCLS
FT                   ASPHLRQPQSTKETVHCFFCPHFKGHEQGLNMNSESDTRAHHKTFYHHRHERQPIHLPP
FT                   RSRSPDSSEDTQCRHNAGHYPAQEIHSNERRNNQFPVKHFYPETSNDPFDRIHRHAASP
FT                   ERSDSSRATDSSRATDSSRATGYKSHEEGCGSSIKAVRFKEDDKMPEHAKTHHPNCPLY
FT                   HAPSPLEDRHDSHCNPRPNQSQSRELRIFRWVIPQLHKNECTPYGYTRLKLPLDPRALV
FT                   "
     MHRIYREPKA KRDILLPHHH TSRQEADRYG HRNMCHVQQD TPCLSASPHL RQPQSTKETV        60
     HCFFCPHFKG HEQGLNMNSE SDTRAHHKTF YHHRHERQPI HLPPRSRSPD SSEDTQCRHN       120
     AGHYPAQEIH SNERRNNQFP VKHFYPETSN DPFDRIHRHA ASPERSDSSR ATDSSRATDS       180
     SRATGYKSHE EGCGSSIKAV RFKEDDKMPE HAKTHHPNCP LYHAPSPLED RHDSHCNPRP       240
     NQSQSRELRI FRWVIPQLHK NECTPYGYTR LKLPLDPRAL V                           281
//

If you have problems or comments...

PBIL Back to PBIL home page