(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE445

PENCW_16.PE445       Location/Qualifiers
FT   CDS             1009315..1010277
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000202734" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129263"
FT                   /orf_name="Pc20g04450"
FT                   /product="Pc20g04450 protein"
FT                   /function="transferase activity, transferring glycosyl
FT                   groups"
FT                   /protein_id="CAP85774.1"
FT                   /db_xref="GO:0016757"
FT                   /db_xref="InterPro:IPR002495"
FT                   /db_xref="UniParc:UPI0001831681"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS1"
FT                   /transl_table=1
FT                   /translation="MVPHRNWAFTPYSRKVIAIVTCLALFLWVATPLGCYGSTDDSKPP
FT                   RYAFATVLMTENDTEFPDIEAPYFQAARLLTFQLLRNPRTRNRIDNVPFLILVTPDIPQ
FT                   RHRDALSREGATVVPMDNLNLDDGSSQRWNAVLTKLNLWKLVEYDKIVFLNVNSVIFRP
FT                   IYDIFEDPATNMRATVTPTAKMPKNYMIAAPHDSRTNSNAQLVLGQESYQKDHMNDGFF
FT                   ILHPSKDLYNYYVSLHHIRDKDESVHPEQDVLDYAHRADGPMPWQNLGPGWNLKDASRS
FT                   DYERGLESINHKWWRPIADDFVGGRIAMAMDEMTAYLNH"
     MVPHRNWAFT PYSRKVIAIV TCLALFLWVA TPLGCYGSTD DSKPPRYAFA TVLMTENDTE        60
     FPDIEAPYFQ AARLLTFQLL RNPRTRNRID NVPFLILVTP DIPQRHRDAL SREGATVVPM       120
     DNLNLDDGSS QRWNAVLTKL NLWKLVEYDK IVFLNVNSVI FRPIYDIFED PATNMRATVT       180
     PTAKMPKNYM IAAPHDSRTN SNAQLVLGQE SYQKDHMNDG FFILHPSKDL YNYYVSLHHI       240
     RDKDESVHPE QDVLDYAHRA DGPMPWQNLG PGWNLKDASR SDYERGLESI NHKWWRPIAD       300
     DFVGGRIAMA MDEMTAYLNH                                                   320
//

If you have problems or comments...

PBIL Back to PBIL home page