(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE446

PENCW_16.PE446       Location/Qualifiers
FT   CDS             join(1011222..1011621,1011659..1012026)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000189036" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978099"
FT                   /orf_name="Pc20g04460"
FT                   /product="Pc20g04460 protein"
FT                   /protein_id="CAP85775.1"
FT                   /db_xref="UniParc:UPI0001831682"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS2"
FT                   /transl_table=1
FT                   /translation="MSDTGGYALRRNGSCLSTETDCGGTTAPFHACCPGNMFCPGRQYN
FT                   VVCCPSNAGCRDIMSDSCADKKADLYSSNTSDLANEGFCCERDSYAFAMKANSGVGCAD
FT                   GLSDLQTSMDQLMAISSASGTYLRIAFVRSIPTPSSTPSTFVTSSPTTTSTTPSSTTST
FT                   GEAKPASSTNTAAIAGGTVGGVAGVAILIALVWFLLRRRNKQRQENGVQDMPPPPTNQT
FT                   QQHFPQSNSGHQATLSELDAQKQQPVVELPSHQ"
     MSDTGGYALR RNGSCLSTET DCGGTTAPFH ACCPGNMFCP GRQYNVVCCP SNAGCRDIMS        60
     DSCADKKADL YSSNTSDLAN EGFCCERDSY AFAMKANSGV GCADGLSDLQ TSMDQLMAIS       120
     SASGTYLRIA FVRSIPTPSS TPSTFVTSSP TTTSTTPSST TSTGEAKPAS STNTAAIAGG       180
     TVGGVAGVAI LIALVWFLLR RRNKQRQENG VQDMPPPPTN QTQQHFPQSN SGHQATLSEL       240
     DAQKQQPVVE LPSHQ                                                        255
//

If you have problems or comments...

PBIL Back to PBIL home page