(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE449

PENCW_16.PE449       Location/Qualifiers
FT   CDS             join(1015617..1015881,1015944..1016749)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949956"
FT                   /orf_name="Pc20g04490"
FT                   /product="Putative uncharacterized protein Pc20g04490 "
FT                   /protein_id="CAP85778.1"
FT                   /db_xref="UniParc:UPI0001831684"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS4"
FT                   /transl_table=1
FT                   /translation="MVRRTMVHPHASTSGVLPEPACLLCGMLIPNTRRSEFPDSGKSHP
FT                   LLQESQWKSLWKPGLEHLLVPSREVENTFTTNFPRLWSCLCRAIIKESDTKYRLTGINL
FT                   IQDRHLNGSYYVPNDPTKARISGKKDFPYDGRVFTRFYAASIKRQPREYKDKTIGYVVH
FT                   AHCWALFGQVEGLKLRDAGLAKFVQVCRKYWKDHELWQIYSDFDRLLYTSTMDIYRNPF
FT                   VLPAIREAIDCAKIEHFRQSSCFNNLPLELAISICQWVCPITDYTEDDIKNTRNLLLVF
FT                   GWELPEWFWRARLNSHLHLFFELDKASKIGSPADWQLWLNLMSLVADRSRFVSTGLANR
FT                   ERVLGVMLALEKIYAD"
     MVRRTMVHPH ASTSGVLPEP ACLLCGMLIP NTRRSEFPDS GKSHPLLQES QWKSLWKPGL        60
     EHLLVPSREV ENTFTTNFPR LWSCLCRAII KESDTKYRLT GINLIQDRHL NGSYYVPNDP       120
     TKARISGKKD FPYDGRVFTR FYAASIKRQP REYKDKTIGY VVHAHCWALF GQVEGLKLRD       180
     AGLAKFVQVC RKYWKDHELW QIYSDFDRLL YTSTMDIYRN PFVLPAIREA IDCAKIEHFR       240
     QSSCFNNLPL ELAISICQWV CPITDYTEDD IKNTRNLLLV FGWELPEWFW RARLNSHLHL       300
     FFELDKASKI GSPADWQLWL NLMSLVADRS RFVSTGLANR ERVLGVMLAL EKIYAD           356
//

If you have problems or comments...

PBIL Back to PBIL home page