(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE45

PENCW_16.PE45        Location/Qualifiers
FT   CDS             join(102765..102767,102844..102888,102944..103082,
FT                   103148..103326)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000159293" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824088"
FT                   /orf_name="Pc20g00450"
FT                   /product="Pc20g00450 protein"
FT                   /protein_id="CAP85374.1"
FT                   /db_xref="InterPro:IPR007808"
FT                   /db_xref="UniParc:UPI00018319E4"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE1"
FT                   /transl_table=1
FT                   /translation="MGKRKKSSSKPQGPRKREPLATTFSCLFCNHENSVVVKLDKKLGL
FT                   GDLSCKVCGQKFQTGINYLSAPVDVYSDWVDACDAVAKDTANQYDAPNPSQLGQRGISK
FT                   QAIPEETGQDDGYDDDY"
     MGKRKKSSSK PQGPRKREPL ATTFSCLFCN HENSVVVKLD KKLGLGDLSC KVCGQKFQTG        60
     INYLSAPVDV YSDWVDACDA VAKDTANQYD APNPSQLGQR GISKQAIPEE TGQDDGYDDD       120
     Y                                                                       121
//

If you have problems or comments...

PBIL Back to PBIL home page