(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE452

PENCW_16.PE452       Location/Qualifiers
FT   CDS             join(complement(1022614..1022654),
FT                   complement(1022465..1022557),complement(1021675..1022410))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824907"
FT                   /orf_name="Pc20g04520"
FT                   /product="Putative uncharacterized protein Pc20g04520 "
FT                   /protein_id="CAP85781.1"
FT                   /db_xref="UniParc:UPI0001831686"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS6"
FT                   /transl_table=1
FT                   /translation="MSVTYHVYHPSHDRYMDPSGNSTSSQHIPSKFLGPVMFHHPSDDL
FT                   QLDHMLLRLPFYMFVSFFPSALIPAHCVLRLGQHEKGLTIHRHVARPPPHKTLHSNWVV
FT                   QPCRDTRKRKKQKQKQKACTFRRFNQAPTFKHQNPNIHFDQPHSVNHIQSTTSTVNHIQ
FT                   STTSRVNHIHSQPHPQSTTSTVNHIHSQPHPQSTTSTVNHPLQSTFQSTFQSTFQSTFQ
FT                   STFQSTFQSASSINHFNQPLQPTIRLSTTLQLCKRRKETKQSWSTRVSAGVSLKETSRR
FT                   EEVQRVPI"
     MSVTYHVYHP SHDRYMDPSG NSTSSQHIPS KFLGPVMFHH PSDDLQLDHM LLRLPFYMFV        60
     SFFPSALIPA HCVLRLGQHE KGLTIHRHVA RPPPHKTLHS NWVVQPCRDT RKRKKQKQKQ       120
     KACTFRRFNQ APTFKHQNPN IHFDQPHSVN HIQSTTSTVN HIQSTTSRVN HIHSQPHPQS       180
     TTSTVNHIHS QPHPQSTTST VNHPLQSTFQ STFQSTFQST FQSTFQSTFQ SASSINHFNQ       240
     PLQPTIRLST TLQLCKRRKE TKQSWSTRVS AGVSLKETSR REEVQRVPI                   289
//

If you have problems or comments...

PBIL Back to PBIL home page