(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE453

PENCW_16.PE453       Location/Qualifiers
FT   CDS             join(1022850..1022905,1023007..1023126,1023392..1023470,
FT                   1023555..1023659,1024020..1024157,1024244..1024290,
FT                   1024374..1024437,1024525..1024742,1024846..1024956,
FT                   1025032..1025151,1025242..1025553,1025773..1026115)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129264"
FT                   /orf_name="Pc20g04530"
FT                   /product="Putative uncharacterized protein Pc20g04530 "
FT                   /protein_id="CAP85782.1"
FT                   /db_xref="UniParc:UPI0001831687"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS7"
FT                   /transl_table=1
FT                   /translation="MEEVMRLKLMMEDLMEDKGGYLYPGGLERVWRVRKYPCTWGVLQG
FT                   TPHFSTSPLQLSAPLHAKLYLVWRICTVLVSRRTTFEGPKSWLASICEWAPVHIMSEVA
FT                   LSPHGHFRWRQNAETPGNKRGLGYEVDTIWDFRGPRRYCRLELHRDRGVMNCSLQGDRM
FT                   YEAMRGADREGNRTSEKHWFVGGIEKGAGENSVLGLPEGVGSAMYSVNKDQLKLAKVKE
FT                   KLRGVYRRRDPVRTHDSRRGRKEGVRCALWMKLADENIPVSCWFRRGIVMETARTRKGI
FT                   KKQSVLSEWKLYKRARESARDQAIGEAFMPNNPQGHCSKYSRPVKGRMDDNGSIGMEEG
FT                   YTPIDSPGSWATSEDNARQCERTGHLSPPLSIFTDESECNRRIGATAVRYTVSFERRCQ
FT                   MGDEDMSTVYQPSSKTSKWPCSRFKKPGTGQWGGRVDGDGGEESEESEGIGKPDRITSR
FT                   GISGWLRKMVTVTKASSILFVAGFMMKPALLAQFQCVDSMATGIRLPRLLVRAVHNHST
FT                   TITITLAGISASSVTTITSCPAPAGGLRHRSTSCYARKRTTLLGTGPANPHNH"
     MEEVMRLKLM MEDLMEDKGG YLYPGGLERV WRVRKYPCTW GVLQGTPHFS TSPLQLSAPL        60
     HAKLYLVWRI CTVLVSRRTT FEGPKSWLAS ICEWAPVHIM SEVALSPHGH FRWRQNAETP       120
     GNKRGLGYEV DTIWDFRGPR RYCRLELHRD RGVMNCSLQG DRMYEAMRGA DREGNRTSEK       180
     HWFVGGIEKG AGENSVLGLP EGVGSAMYSV NKDQLKLAKV KEKLRGVYRR RDPVRTHDSR       240
     RGRKEGVRCA LWMKLADENI PVSCWFRRGI VMETARTRKG IKKQSVLSEW KLYKRARESA       300
     RDQAIGEAFM PNNPQGHCSK YSRPVKGRMD DNGSIGMEEG YTPIDSPGSW ATSEDNARQC       360
     ERTGHLSPPL SIFTDESECN RRIGATAVRY TVSFERRCQM GDEDMSTVYQ PSSKTSKWPC       420
     SRFKKPGTGQ WGGRVDGDGG EESEESEGIG KPDRITSRGI SGWLRKMVTV TKASSILFVA       480
     GFMMKPALLA QFQCVDSMAT GIRLPRLLVR AVHNHSTTIT ITLAGISASS VTTITSCPAP       540
     AGGLRHRSTS CYARKRTTLL GTGPANPHNH                                        570
//

If you have problems or comments...

PBIL Back to PBIL home page