(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE454

PENCW_16.PE454       Location/Qualifiers
FT   CDS             join(complement(1027241..1027376),
FT                   complement(1026818..1027160),complement(1026578..1026711),
FT                   complement(1026400..1026489),complement(1026142..1026323))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949958"
FT                   /orf_name="Pc20g04540"
FT                   /product="Putative uncharacterized protein Pc20g04540 "
FT                   /protein_id="CAP85783.1"
FT                   /db_xref="UniParc:UPI0001831688"
FT                   /db_xref="UniProtKB/TrEMBL:B6HDS8"
FT                   /transl_table=1
FT                   /translation="MVHYCKTAKYSNVALAESTKIPPDKPHNAVLGLFISSLVSGLRLT
FT                   VFRLSHLAPVSSLPPSMARAVRYIGIAAHSLHSPHLAYIAQLPGSLYLHFSIRSLPASS
FT                   PPSTSYYQSSPSPRVPTSLLKPTNAVAFVNSMACPFILDPVVDIVDFARGISRLDGFKV
FT                   VVVVVVIVVLIKVYRRAGVAHTPATSLGVLGRAELWNYVHEYECSYLQSQGIPVVSFVS
FT                   WCSVAGDVAPVYLSVGGMVLDEGSGEVRVGQPAFLGSPAALVSARGLSPCADCGVEAGD
FT                   TEEFAELGRADPA"
     MVHYCKTAKY SNVALAESTK IPPDKPHNAV LGLFISSLVS GLRLTVFRLS HLAPVSSLPP        60
     SMARAVRYIG IAAHSLHSPH LAYIAQLPGS LYLHFSIRSL PASSPPSTSY YQSSPSPRVP       120
     TSLLKPTNAV AFVNSMACPF ILDPVVDIVD FARGISRLDG FKVVVVVVVI VVLIKVYRRA       180
     GVAHTPATSL GVLGRAELWN YVHEYECSYL QSQGIPVVSF VSWCSVAGDV APVYLSVGGM       240
     VLDEGSGEVR VGQPAFLGSP AALVSARGLS PCADCGVEAG DTEEFAELGR ADPA             294
//

If you have problems or comments...

PBIL Back to PBIL home page