(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE455

PENCW_16.PE455       Location/Qualifiers
FT   CDS             join(1027580..1028247,1028301..1029002,1029050..1029926)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000206405" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672208"
FT                   /orf_name="Pc20g04550"
FT                   /product="Pc20g04550 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85784.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR001214"
FT                   /db_xref="InterPro:IPR001440"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="InterPro:IPR013026"
FT                   /db_xref="InterPro:IPR019734"
FT                   /db_xref="UniParc:UPI0001831689"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE27"
FT                   /transl_table=1
FT                   /translation="MDTHDVSDVPEYFRYLQAQKQNLKNAQAVKGRPARSPKSKDEILM
FT                   QFMFRQMMRKEAPASPMNIRSSFLPPAYPPCVSPFSKLKKVMIESLRLETHHRERYLLL
FT                   RTVTSTDTMTAVMAIVEDEDGSVLMLQLYNQEEQLSGAQSLREGTVLVVKEPYVKVMAD
FT                   GDYGIRVDHLSDVSFIPEFDDLVPLPWRKRVTQADGNASSWKEKGSEHFEKGDYHSAIQ
FT                   CYSKALETHPSPEVLVIAQLNRALSLLKSYSFDAALGDVEDVLQVSEMSEKALFRKAQA
FT                   LYQLRRLNESCQTHEILAEKYPDNTLAAHEYARASARLVEQDSGKYEFRKMILEAKKRQ
FT                   PPRLDRGTYIGPVTVKQTQSHGRGLFTTQAVKAGDLLFCEKAFAHAFHDENGSKDLRLL
FT                   LNVDMDEATIGTQGELIGLIVQKLSKNPSLLPGFVDLHHGTYKSLDVLEVDGIPIVDTF
FT                   LVERIILLNSFGCPLLSRESHIRTVKGDDDKDKESNKQFHSSGVWPMASYINHSCLSNA
FT                   RRSFIGDMMIVRASRDLPPNTEITFWYKSPMTRDPKESPVNLQHWGFKCDCIFCQDTRS
FT                   VSGSVLSNRNRISSDLRRLFKTSKMNLRKIEDKISTLASTYCRPASEVPRLALDSPYLS
FT                   LAAIYASSRNHKKAVEFGLMCLESLGFVVKGGKIPHVSEVPLVVQKWGLMTDGVVGCWM
FT                   ILCSAYQELAPILASQAEEYARVSYRICVGEDETFDRTYSRLSNRVDGFLMTAK"
     MDTHDVSDVP EYFRYLQAQK QNLKNAQAVK GRPARSPKSK DEILMQFMFR QMMRKEAPAS        60
     PMNIRSSFLP PAYPPCVSPF SKLKKVMIES LRLETHHRER YLLLRTVTST DTMTAVMAIV       120
     EDEDGSVLML QLYNQEEQLS GAQSLREGTV LVVKEPYVKV MADGDYGIRV DHLSDVSFIP       180
     EFDDLVPLPW RKRVTQADGN ASSWKEKGSE HFEKGDYHSA IQCYSKALET HPSPEVLVIA       240
     QLNRALSLLK SYSFDAALGD VEDVLQVSEM SEKALFRKAQ ALYQLRRLNE SCQTHEILAE       300
     KYPDNTLAAH EYARASARLV EQDSGKYEFR KMILEAKKRQ PPRLDRGTYI GPVTVKQTQS       360
     HGRGLFTTQA VKAGDLLFCE KAFAHAFHDE NGSKDLRLLL NVDMDEATIG TQGELIGLIV       420
     QKLSKNPSLL PGFVDLHHGT YKSLDVLEVD GIPIVDTFLV ERIILLNSFG CPLLSRESHI       480
     RTVKGDDDKD KESNKQFHSS GVWPMASYIN HSCLSNARRS FIGDMMIVRA SRDLPPNTEI       540
     TFWYKSPMTR DPKESPVNLQ HWGFKCDCIF CQDTRSVSGS VLSNRNRISS DLRRLFKTSK       600
     MNLRKIEDKI STLASTYCRP ASEVPRLALD SPYLSLAAIY ASSRNHKKAV EFGLMCLESL       660
     GFVVKGGKIP HVSEVPLVVQ KWGLMTDGVV GCWMILCSAY QELAPILASQ AEEYARVSYR       720
     ICVGEDETFD RTYSRLSNRV DGFLMTAK                                          748
//

If you have problems or comments...

PBIL Back to PBIL home page