(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE456

PENCW_16.PE456       Location/Qualifiers
FT   CDS             join(1030473..1030614,1030661..1030848)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000185320" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129265"
FT                   /orf_name="Pc20g04560"
FT                   /product="Pc20g04560 protein"
FT                   /protein_id="CAP85785.1"
FT                   /db_xref="InterPro:IPR011058"
FT                   /db_xref="UniParc:UPI000183168A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE28"
FT                   /transl_table=1
FT                   /translation="MSFHRSACDIRLRADSGCTFLSAICNNEEGSGLADNIPLDECLGN
FT                   ENGHFSWGGRNFSHDARNITLTRGPDRSPVLHSDLRNSSGDFVPSEIDLATHIANIDGK
FT                   LVYLY"
     MSFHRSACDI RLRADSGCTF LSAICNNEEG SGLADNIPLD ECLGNENGHF SWGGRNFSHD        60
     ARNITLTRGP DRSPVLHSDL RNSSGDFVPS EIDLATHIAN IDGKLVYLY                   109
//

If you have problems or comments...

PBIL Back to PBIL home page