(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE458

PENCW_16.PE458       Location/Qualifiers
FT   CDS             join(complement(1032658..1032835),
FT                   complement(1032329..1032606))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949959"
FT                   /orf_name="Pc20g04580"
FT                   /product="Pc20g04580 protein"
FT                   /function="RNA binding"
FT                   /function="ribonuclease III activity"
FT                   /biological_process="RNA processing"
FT                   /protein_id="CAP85787.1"
FT                   /db_xref="GO:0003723"
FT                   /db_xref="GO:0004525"
FT                   /db_xref="GO:0006396"
FT                   /db_xref="InterPro:IPR000999"
FT                   /db_xref="UniParc:UPI000183168B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE29"
FT                   /transl_table=1
FT                   /translation="MGAELESLIGYQFHDRSLLEEALEEAGPQTEGNERLALLGDKVLS
FT                   LMLLHRWYMEGNTTEQGTNLLQIYAGNKHLISRARALDFPKFVIQRLDIKRSVPDHTLA
FT                   TTVKAILGAVWLDSEESVRNVKNSMERIGLYPPEISLYPPKFGNQKQ"
     MGAELESLIG YQFHDRSLLE EALEEAGPQT EGNERLALLG DKVLSLMLLH RWYMEGNTTE        60
     QGTNLLQIYA GNKHLISRAR ALDFPKFVIQ RLDIKRSVPD HTLATTVKAI LGAVWLDSEE       120
     SVRNVKNSME RIGLYPPEIS LYPPKFGNQK Q                                      151
//

If you have problems or comments...

PBIL Back to PBIL home page