(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE46

PENCW_16.PE46        Location/Qualifiers
FT   CDS             join(complement(104422..104579),complement(104003..104361),
FT                   complement(103774..103945),complement(103668..103719))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000262755" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15946689"
FT                   /orf_name="Pc20g00460"
FT                   /product="Pc20g00460 protein"
FT                   /protein_id="CAP85375.1"
FT                   /db_xref="UniParc:UPI00018319E5"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE2"
FT                   /transl_table=1
FT                   /translation="MASKPESGPSPAQGVGPLYRPDGEKPTATVSKEVSYDNVHVLPQT
FT                   PQLIALLTMIRDKRTSRADFIFYSNRIIRLLVEEGLNHLPVVEQSITTPVGRSYLGVKF
FT                   EGKICGVSIMRAGEAMEQGLRDCCRSVRIGKILIQRDEESCMPKLFYDKLPSDIADRWV
FT                   LLLDPMFATGGSATLAVETLIERGVPEHRILFLNLIASPSGVAEFAERFPKLRVVTSFI
FT                   DQGLDEKKYIIPGLGDFGDRYYSM"
     MASKPESGPS PAQGVGPLYR PDGEKPTATV SKEVSYDNVH VLPQTPQLIA LLTMIRDKRT        60
     SRADFIFYSN RIIRLLVEEG LNHLPVVEQS ITTPVGRSYL GVKFEGKICG VSIMRAGEAM       120
     EQGLRDCCRS VRIGKILIQR DEESCMPKLF YDKLPSDIAD RWVLLLDPMF ATGGSATLAV       180
     ETLIERGVPE HRILFLNLIA SPSGVAEFAE RFPKLRVVTS FIDQGLDEKK YIIPGLGDFG       240
     DRYYSM                                                                  246
//

If you have problems or comments...

PBIL Back to PBIL home page