(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE460

PENCW_16.PE460       Location/Qualifiers
FT   CDS             join(1036195..1036286,1036346..1036658)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000187032" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129267"
FT                   /orf_name="Pc20g04600"
FT                   /product="Pc20g04600 protein"
FT                   /biological_process="fruiting body development "
FT                   /biological_process="hemolysis by symbiont of host
FT                   erythrocytes"
FT                   /protein_id="CAP85789.1"
FT                   /db_xref="GO:0019836"
FT                   /db_xref="GO:0030582"
FT                   /db_xref="InterPro:IPR009413"
FT                   /db_xref="UniParc:UPI000183175F"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE31"
FT                   /transl_table=1
FT                   /translation="MASSLSQKSLQIQIQDDLKYDIRIENAKLESGKFYNEDDQSDILT
FT                   SEDVDDMVIRHNGGIRSVCSMDGSEGSIDLVDDVRDAKICNLTWRASPEGGERNEIKKL
FT                   NEDTRYMVDIGSWNESGTVGSVLVTVKDQE"
     MASSLSQKSL QIQIQDDLKY DIRIENAKLE SGKFYNEDDQ SDILTSEDVD DMVIRHNGGI        60
     RSVCSMDGSE GSIDLVDDVR DAKICNLTWR ASPEGGERNE IKKLNEDTRY MVDIGSWNES       120
     GTVGSVLVTV KDQE                                                         134
//

If you have problems or comments...

PBIL Back to PBIL home page