(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE461

PENCW_16.PE461       Location/Qualifiers
FT   CDS             complement(1037206..1040700)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000200201" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672209"
FT                   /orf_name="Pc20g04610"
FT                   /product="Pc20g04610 protein"
FT                   /function="flavin adenine dinucleotide binding "
FT                   /function="oxidoreductase activity"
FT                   /function="phosphomevalonate kinase activity"
FT                   /biological_process="cholesterol biosynthetic process "
FT                   /biological_process="nucleoside metabolic process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85790.1"
FT                   /db_xref="GO:0004631"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0006695"
FT                   /db_xref="GO:0009116"
FT                   /db_xref="GO:0016491"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="InterPro:IPR000836"
FT                   /db_xref="InterPro:IPR005919"
FT                   /db_xref="InterPro:IPR006094"
FT                   /db_xref="InterPro:IPR016166"
FT                   /db_xref="InterPro:IPR016168"
FT                   /db_xref="UniParc:UPI0001831760"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE32"
FT                   /transl_table=1
FT                   /translation="MATLESLKLALRQKATEKASTSKQPLSDAQYSAGFDTFVQGSGWM
FT                   TYRDFILPQICQLLTQLLGSRSCISVLEIGPGPKSILGHLPSDLRRKVKRYSAFEPNNL
FT                   FATKVQKWLSFESDIESPFPCLERTPDIHRTPFIVNSPTGGDTGSVTRDSDEKFDVIIF
FT                   CHSMYGLNPKAKFIEQALQMLVEQPKSGIVVVFHRDGTLNLDGLVCNETAPFPTGTISV
FT                   PNNDAVLDLFAPFVAGFAMQDKEADKVLLAEWREVCRVLSRREETHPGHLFFSSPNLMA
FT                   TFTRQSTALPELTAQVPLLEGDLKVKNREARLHYPASIFRPTEIRHVQDCIRWALKHGV
FT                   GLTVVGGGHSGHCLWDNVVAVDMGAFDQVHVLQARNGGAESGFDCTPLVVAEAGCKTGD
FT                   IIRNAMAMGITVPLGARPSVGAGLWLQGGIGHLARMYGLACDAIVGAVIVSVDSSQVFC
FT                   IGHVPSQHQPVGAVRPGNETDLLWGIKGAGTNFGIVVSVTFKAFPSPTYSVRNWIAPLN
FT                   DSLEAQVKLSEFDEYVARRLPRNCSADAYLYWDIGQLRLGVTMFESFETRPSSETPIPF
FT                   PLPTSSGTILGPEDNFKFVDGVGLFEAEMYMSGMHGGHGGSRTSSFKRCLFLKDIGAPE
FT                   VTNSLVTAIKTRPSPLCYLHLLQGGGAVVDVAADAAAFGCRDWDFACVVTGVWSRDQDG
FT                   TEVARTAVRWVYSIAMDLLPLSSGVYGADLGPDPRDAALAVEAFGPNRPRLARLKQSSD
FT                   PRNVLAYTCPLEQVPIKPKLIILVTGDSCAGKDYCANIWVSAFLECTQKSLVARAVSIS
FT                   DTTKREYAAATGADLNRLLCDRAYKEQHRPALTTFFQSQVRHRPRLPEEHFLKAVYGAV
FT                   DTDVLLITGMRDDAPVATFSHLVPDSRLLEVCVEASKPTRCTRRGCQDGDGADHHADNN
FT                   NSWSKPKPLDYRPSLIFNNDLTGSEAAQRFAELNLLPFFHKDLQRLADMVRPVSNFPRP
FT                   GVEFRHVLNISQQRGGLTLCTYLLQTHFAGAWGEVDVLACCEAGGFVYASALALQVNVP
FT                   LALIREAGKLPTPTVSIFKPTSHISSSTSDDLEGSRIEMERDLIPKGASVVVVDDVLAT
FT                   GKTLCAVLDLLNKANICAKDVSIMVVAEFPVHRGRELLRQRGFGGVNIQSLLVFGGA"
     MATLESLKLA LRQKATEKAS TSKQPLSDAQ YSAGFDTFVQ GSGWMTYRDF ILPQICQLLT        60
     QLLGSRSCIS VLEIGPGPKS ILGHLPSDLR RKVKRYSAFE PNNLFATKVQ KWLSFESDIE       120
     SPFPCLERTP DIHRTPFIVN SPTGGDTGSV TRDSDEKFDV IIFCHSMYGL NPKAKFIEQA       180
     LQMLVEQPKS GIVVVFHRDG TLNLDGLVCN ETAPFPTGTI SVPNNDAVLD LFAPFVAGFA       240
     MQDKEADKVL LAEWREVCRV LSRREETHPG HLFFSSPNLM ATFTRQSTAL PELTAQVPLL       300
     EGDLKVKNRE ARLHYPASIF RPTEIRHVQD CIRWALKHGV GLTVVGGGHS GHCLWDNVVA       360
     VDMGAFDQVH VLQARNGGAE SGFDCTPLVV AEAGCKTGDI IRNAMAMGIT VPLGARPSVG       420
     AGLWLQGGIG HLARMYGLAC DAIVGAVIVS VDSSQVFCIG HVPSQHQPVG AVRPGNETDL       480
     LWGIKGAGTN FGIVVSVTFK AFPSPTYSVR NWIAPLNDSL EAQVKLSEFD EYVARRLPRN       540
     CSADAYLYWD IGQLRLGVTM FESFETRPSS ETPIPFPLPT SSGTILGPED NFKFVDGVGL       600
     FEAEMYMSGM HGGHGGSRTS SFKRCLFLKD IGAPEVTNSL VTAIKTRPSP LCYLHLLQGG       660
     GAVVDVAADA AAFGCRDWDF ACVVTGVWSR DQDGTEVART AVRWVYSIAM DLLPLSSGVY       720
     GADLGPDPRD AALAVEAFGP NRPRLARLKQ SSDPRNVLAY TCPLEQVPIK PKLIILVTGD       780
     SCAGKDYCAN IWVSAFLECT QKSLVARAVS ISDTTKREYA AATGADLNRL LCDRAYKEQH       840
     RPALTTFFQS QVRHRPRLPE EHFLKAVYGA VDTDVLLITG MRDDAPVATF SHLVPDSRLL       900
     EVCVEASKPT RCTRRGCQDG DGADHHADNN NSWSKPKPLD YRPSLIFNND LTGSEAAQRF       960
     AELNLLPFFH KDLQRLADMV RPVSNFPRPG VEFRHVLNIS QQRGGLTLCT YLLQTHFAGA      1020
     WGEVDVLACC EAGGFVYASA LALQVNVPLA LIREAGKLPT PTVSIFKPTS HISSSTSDDL      1080
     EGSRIEMERD LIPKGASVVV VDDVLATGKT LCAVLDLLNK ANICAKDVSI MVVAEFPVHR      1140
     GRELLRQRGF GGVNIQSLLV FGGA                                             1164
//

If you have problems or comments...

PBIL Back to PBIL home page