(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE465

PENCW_16.PE465       Location/Qualifiers
FT   CDS             join(1046873..1046915,1046951..1047099,1047347..1047367,
FT                   1047421..1047479,1047538..1047616)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949961"
FT                   /orf_name="Pc20g04650"
FT                   /product="Putative uncharacterized protein Pc20g04650 "
FT                   /protein_id="CAP85794.1"
FT                   /db_xref="UniParc:UPI0001831763"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE35"
FT                   /transl_table=1
FT                   /translation="MSSSGYLTAKAVSVNKKCCTPLPYAAEQGSHKTVKFPAEDKKADI
FT                   DSKDYGHAIYSTTIGDRYTILDMHGMFAIPLLVQASYTACISIDSYIVALNSDTAHEAS
FT                   RSLRLSSLRSIR"
     MSSSGYLTAK AVSVNKKCCT PLPYAAEQGS HKTVKFPAED KKADIDSKDY GHAIYSTTIG        60
     DRYTILDMHG MFAIPLLVQA SYTACISIDS YIVALNSDTA HEASRSLRLS SLRSIR           116
//

If you have problems or comments...

PBIL Back to PBIL home page