(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE466

PENCW_16.PE466       Location/Qualifiers
FT   CDS             join(1048023..1048552,1048617..1048694,1048757..1048907)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000217817" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129268"
FT                   /orf_name="Pc20g04660"
FT                   /product="Pc20g04660 protein"
FT                   /protein_id="CAP85795.1"
FT                   /db_xref="UniParc:UPI0001831764"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE36"
FT                   /transl_table=1
FT                   /translation="MTSQHSRFVGAELYSISFDAPTPSTWIVIERVNEHEHRKDPDHSA
FT                   VSYASVKYRCKKDGDASKNAFVRIYKQLPHLGTEFGDHATRANQARAWTPPELVAYKTL
FT                   TDKQSKVTPSLLGYKEEKQDSSAIVPAGFLVSFAWEQVPGVQLGDSLGGKVFWGMSDHQ
FT                   RHIIREAFKNKTIPETETIGIHPLFYGPSHLVWDSVSGNLFMVGFRQWIEVKPTPWSEA
FT                   KSYWFDLAKPPKKVNWSEFVKNPDTSNWEF"
     MTSQHSRFVG AELYSISFDA PTPSTWIVIE RVNEHEHRKD PDHSAVSYAS VKYRCKKDGD        60
     ASKNAFVRIY KQLPHLGTEF GDHATRANQA RAWTPPELVA YKTLTDKQSK VTPSLLGYKE       120
     EKQDSSAIVP AGFLVSFAWE QVPGVQLGDS LGGKVFWGMS DHQRHIIREA FKNKTIPETE       180
     TIGIHPLFYG PSHLVWDSVS GNLFMVGFRQ WIEVKPTPWS EAKSYWFDLA KPPKKVNWSE       240
     FVKNPDTSNW EF                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page