(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE467

PENCW_16.PE467       Location/Qualifiers
FT   CDS             join(complement(1050224..1050307),
FT                   complement(1049925..1050119),complement(1049677..1049730))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI15949962"
FT                   /orf_name="Pc20g04670"
FT                   /product="Putative uncharacterized protein Pc20g04670 "
FT                   /protein_id="CAP85796.1"
FT                   /db_xref="UniParc:UPI0001831765"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE37"
FT                   /transl_table=1
FT                   /translation="MAVAAGDLMGTQMKRAPEKWWDRTEVSLNQPGLFIEKKSWKCMKS
FT                   DDKEKEQSPMAFPFAALWFFSSLYEAKGTLMIVFLQLLVKNLGATKEADFVAIGVSEAE
FT                   GVCDCR"
     MAVAAGDLMG TQMKRAPEKW WDRTEVSLNQ PGLFIEKKSW KCMKSDDKEK EQSPMAFPFA        60
     ALWFFSSLYE AKGTLMIVFL QLLVKNLGAT KEADFVAIGV SEAEGVCDCR                  110
//

If you have problems or comments...

PBIL Back to PBIL home page