(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE468

PENCW_16.PE468       Location/Qualifiers
FT   CDS             join(complement(1051581..1051824),
FT                   complement(1051478..1051534),complement(1051149..1051429),
FT                   complement(1050636..1050980))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978100"
FT                   /orf_name="Pc20g04680"
FT                   /product="Putative uncharacterized protein Pc20g04680 "
FT                   /protein_id="CAP85797.1"
FT                   /db_xref="UniParc:UPI0001831766"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE38"
FT                   /transl_table=1
FT                   /translation="MFRTATTLSQAINKPHAARGNISSPQFYQLMHEQDGDDARLPSVR
FT                   LSLLNASEVEHILCLEPAKTNQGLDSFPTIPPPELLLKNLAMIDGALKNEKSAEATMDS
FT                   YSEKEELLEIHREPKWSFGPVRYKDQAVKLSGYPSYALWYGDEDEAALKVIVTQSKRLK
FT                   RYDKGIPEVLGYIGEYNVPLLVMQCLLTDLVFVTATLDSEVDLEKVFSLLVHILKEALI
FT                   VQSTQPKEPSMQSNQGEGSAEPLVPAGSSLRRKVAKKTQYKKLKAAVALDEDLDYYDID
FT                   ERDLEAEFPADETSEDEYCEDDYAEDE"
     MFRTATTLSQ AINKPHAARG NISSPQFYQL MHEQDGDDAR LPSVRLSLLN ASEVEHILCL        60
     EPAKTNQGLD SFPTIPPPEL LLKNLAMIDG ALKNEKSAEA TMDSYSEKEE LLEIHREPKW       120
     SFGPVRYKDQ AVKLSGYPSY ALWYGDEDEA ALKVIVTQSK RLKRYDKGIP EVLGYIGEYN       180
     VPLLVMQCLL TDLVFVTATL DSEVDLEKVF SLLVHILKEA LIVQSTQPKE PSMQSNQGEG       240
     SAEPLVPAGS SLRRKVAKKT QYKKLKAAVA LDEDLDYYDI DERDLEAEFP ADETSEDEYC       300
     EDDYAEDE                                                                308
//

If you have problems or comments...

PBIL Back to PBIL home page