(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE469

PENCW_16.PE469       Location/Qualifiers
FT   CDS             join(1052849..1052878,1053110..1054150)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000201478" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI19824909"
FT                   /orf_name="Pc20g04690"
FT                   /product="Pc20g04690 protein"
FT                   /protein_id="CAP85798.1"
FT                   /db_xref="UniParc:UPI0001831767"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE39"
FT                   /transl_table=1
FT                   /translation="MLRPRCCSAPFSTLLLDPPPATPAVTDGFPACFRIRSNRVMLPAN
FT                   SIDEFISSELSLRRLEVLERHLWFAGEERSAWPLHHHILVGRKILITEQMDLHLLWAND
FT                   GRLFIKPLSRFLLNPEFWSKKLSCEEPTKCKDHRPTPNTSGSPRTTNSTEPLCDRRSLR
FT                   SCAMGFLYTYACLISYESDFRIANENNLLPCRSNGSTFSWEDWKKFVSEILAHYNKDDI
FT                   HPRFHRAELRLARLNTIHRFTQLPLLEPYFRDWRNFGSVFRDNLTWLASATVFVALVLT
FT                   AMQVGLATDQLKGSKSFMAASYGFTVFAILGPLCAFGLIILGVLHHLLKELPWLLRGEP
FT                   TPLKSPPVSARSMSQV"
     MLRPRCCSAP FSTLLLDPPP ATPAVTDGFP ACFRIRSNRV MLPANSIDEF ISSELSLRRL        60
     EVLERHLWFA GEERSAWPLH HHILVGRKIL ITEQMDLHLL WANDGRLFIK PLSRFLLNPE       120
     FWSKKLSCEE PTKCKDHRPT PNTSGSPRTT NSTEPLCDRR SLRSCAMGFL YTYACLISYE       180
     SDFRIANENN LLPCRSNGST FSWEDWKKFV SEILAHYNKD DIHPRFHRAE LRLARLNTIH       240
     RFTQLPLLEP YFRDWRNFGS VFRDNLTWLA SATVFVALVL TAMQVGLATD QLKGSKSFMA       300
     ASYGFTVFAI LGPLCAFGLI ILGVLHHLLK ELPWLLRGEP TPLKSPPVSA RSMSQV           356
//

If you have problems or comments...

PBIL Back to PBIL home page