(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE47

PENCW_16.PE47        Location/Qualifiers
FT   CDS             join(105210..107396,107458..107736)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG-ORPHANS-" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20671391"
FT                   /orf_name="Pc20g00470"
FT                   /product="Pc20g00470 protein"
FT                   /protein_id="CAP85376.1"
FT                   /db_xref="InterPro:IPR022771"
FT                   /db_xref="UniParc:UPI0001831AB2"
FT                   /db_xref="UniProtKB/TrEMBL:B6HFE3"
FT                   /transl_table=1
FT                   /translation="MDNSHPRNRRLVTYGSAAKSQPPSNTEKTVRSSATRTTSKEMPLP
FT                   SSSRPSRPVYTRLQRDKNGDKQLSGPAKTTTARGVTQPKPITEANVYDFPSSDDEQMSM
FT                   IQRKRRRYSPNGNKAVPATKRSAKPSETGNGVHNVSPPMGKRGSDGRRPLAKKLEADER
FT                   TSSVASTSYSRPGRSVRNQTKLPTVENEMGVSTAEGLGDGESIRKSSPDINQGYATKAN
FT                   VTPGRRRLIDSLGITQSPVETSPAVETPLESPADSQPPPDPTTPDRASPSAAVNECPAE
FT                   SHVQDSPASVPSHLRGSRVTYARQRSFLDDLIMSEDLSTHNASSGLRHRSQSVQRQLNY
FT                   EATSSARLIVPNEDTNDDGSVRSIHELRQAGGNARYRGAVESIFEDIEDSQNSLTGRCN
FT                   AFLQLCGKLLDTGLKRRFVECNFDKRLVDCLSMDLQVVPTILAFCAYALGSSDGHMSYV
FT                   LATSAWPKLQEASPALLGMHDDIPVAARAQASGLSRPLQKTIQNTIPQIAAMLFPDTAL
FT                   SKLSPCILALYCLRSTMSTTQTKGENPSLSKSLLKPLVQALVLEGQRCASLGKIHPESS
FT                   EILCMGFSILESSTALAESFTKDHWDILDPLSELHSLLCLESGTAGQIQLLYIRLILNV
FT                   TNSNPSLCDRFATPEMVGGLVRIVSAKFGDLTEDALGQANSSLDSVILALGALINLTEQ
FT                   SEASRSIFLHSADSSKLFLDQLLHLFMTRVDSISTAHSVLEVHHNVAVGYLAVLLLTLS
FT                   LDPATRSKIKSSLAPNGLTTVISTVDEFLQYHQKIEQEISTSPTQGQPASGFLSRLQEL
FT                   ITRIRLAEQ"
     MDNSHPRNRR LVTYGSAAKS QPPSNTEKTV RSSATRTTSK EMPLPSSSRP SRPVYTRLQR        60
     DKNGDKQLSG PAKTTTARGV TQPKPITEAN VYDFPSSDDE QMSMIQRKRR RYSPNGNKAV       120
     PATKRSAKPS ETGNGVHNVS PPMGKRGSDG RRPLAKKLEA DERTSSVAST SYSRPGRSVR       180
     NQTKLPTVEN EMGVSTAEGL GDGESIRKSS PDINQGYATK ANVTPGRRRL IDSLGITQSP       240
     VETSPAVETP LESPADSQPP PDPTTPDRAS PSAAVNECPA ESHVQDSPAS VPSHLRGSRV       300
     TYARQRSFLD DLIMSEDLST HNASSGLRHR SQSVQRQLNY EATSSARLIV PNEDTNDDGS       360
     VRSIHELRQA GGNARYRGAV ESIFEDIEDS QNSLTGRCNA FLQLCGKLLD TGLKRRFVEC       420
     NFDKRLVDCL SMDLQVVPTI LAFCAYALGS SDGHMSYVLA TSAWPKLQEA SPALLGMHDD       480
     IPVAARAQAS GLSRPLQKTI QNTIPQIAAM LFPDTALSKL SPCILALYCL RSTMSTTQTK       540
     GENPSLSKSL LKPLVQALVL EGQRCASLGK IHPESSEILC MGFSILESST ALAESFTKDH       600
     WDILDPLSEL HSLLCLESGT AGQIQLLYIR LILNVTNSNP SLCDRFATPE MVGGLVRIVS       660
     AKFGDLTEDA LGQANSSLDS VILALGALIN LTEQSEASRS IFLHSADSSK LFLDQLLHLF       720
     MTRVDSISTA HSVLEVHHNV AVGYLAVLLL TLSLDPATRS KIKSSLAPNG LTTVISTVDE       780
     FLQYHQKIEQ EISTSPTQGQ PASGFLSRLQ ELITRIRLAE Q                           821
//

If you have problems or comments...

PBIL Back to PBIL home page