(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE470

PENCW_16.PE470       Location/Qualifiers
FT   CDS             join(1054706..1055500,1055550..1058976,1059010..1059254)
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000201479" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672210"
FT                   /orf_name="Pc20g04700"
FT                   /product="Pc20g04700 protein"
FT                   /function="binding"
FT                   /protein_id="CAP85799.1"
FT                   /db_xref="GO:0005488"
FT                   /db_xref="InterPro:IPR007111"
FT                   /db_xref="InterPro:IPR011989"
FT                   /db_xref="InterPro:IPR016024"
FT                   /db_xref="UniParc:UPI0001831768"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE40"
FT                   /transl_table=1
FT                   /translation="MPTFNSSGFKSSNPDEPLETSQNVRGVKLDQVYPPPESTAETDID
FT                   IIAIHGLDTKSPDTWTWKKDGISVNWLKDSNMLPEKVPMARIFTCDWPSDLFERRDFVQ
FT                   KTIEEFARLMLAGIKGRRSSMNQSQLQGSERPIIFVASCLGGVILMKMLVMATHEYDCV
FT                   KKATRGFVFLATPFRGTSFEEVVFWAKPGLITRGLFRGKKPSNLMNYVMPARDLEILVG
FT                   QFSTVCEDENLTNDLFTFYETGVTSLPRKAIPYIPKALAKLKPLVNSSSATLDFAKHPL
FT                   PIEQPHVLVNKFQGPGDPGYCHVSDAVQGLVCKARSGRPIERAKAWIRDNRYSLRKLEI
FT                   ERLSGKKLPMDQCYINLAIVEQQRSISQSDKTKTAFEYSPFSLQTRLNLMAPGEETEAN
FT                   LPNIFEPREKRNGQRMTPNRILIRGRAGVGKTTLCKKIVYEFTYGKMWHSLFEHVLWVP
FT                   LRKLKLKERKKIAGYNFGHMFCHEFFSQIPSTAEMEELSNALWRTLGDGDNTKTLFLLD
FT                   GLDEVSQDVNGDMRDFLEELLNQPNVIVTSRPNAISTAFLRQPFDLELETIGFYPKQVT
FT                   SYIETAFTEIETGQMDSQAVNNIESFLETRQLMQDLVRIPIQLDALCYTWHEFQRKTDA
FT                   VPETMTGVYTAMELSLWKKDVVNLGRRTEVEIEFASDGTIRKLVKLEAEALQLVAFTGM
FT                   YNDIIDFAPQHRDTIFEHVDSNCLDDQWLGRVSFLRTSDSSSDNRNRDYHFLHLTFQEY
FT                   FAALHFVRKWKADEDLEFSNLATGEKIRISPAEFLGINKYSARYDIVWRFVAGLLDLNG
FT                   GPKEPERFFRALDQKPLDLLGIAHQRIVMNCLSEIQSEFSLRSKIESHLSKWLAFQCKT
FT                   ILEQDQRLLKESIITLASEIEFPENALTGLLKENDEKVMTVALLSVKKRHQIQSQIMEI
FT                   ATSLLQRTKSSDVAISMFTFLRRQRENLSEESLDLMVLHLQNPDRGVRLSAADTIRGFA
FT                   LPDRTCRKVIETGVIQRRRDNRFEGFEGMALSDQSMSKETLTDLIASLESPDKNIRRVA
FT                   SDVLSHRSDFLPEEVTSIMAKIEHQDSDVRWCSFNALRGQSHSSGMFTGLLWPEVNGSS
FT                   KKISNCALEVLYQLSNSSEDLLERIIVELLPHRSCWHILKSYCNRSRLSKKALNALETH
FT                   LGSPDYGLRCAAINILAGQPDLSFSILNRIVEQLEDGTSKVRTAAVYAIRRQPRLPIET
FT                   ALEIARRFKNDKLPSKIVLQIFEHQSNSPKEVLVQIARCIEDQDVSIRSAAIRALSGQS
FT                   NLSDLPEIHEKVIAYIEDSDAEVREAAIQAVSVGRPSMSDTTFDTIATRMDDTNEKVRL
FT                   AVVQVLGQKETLCFDIVNTLADLMNDTDEKVRWATLKVLADQSTWPGAIRHKIASKVYC
FT                   PLAFRVKREEFHLNFLLGGLAKQILRLLLLRTSRMHLAWYIHNDMSYVERSDGSKAPLP
FT                   CAGADIELGMMSAREEAGIPPVAVLYS"
     MPTFNSSGFK SSNPDEPLET SQNVRGVKLD QVYPPPESTA ETDIDIIAIH GLDTKSPDTW        60
     TWKKDGISVN WLKDSNMLPE KVPMARIFTC DWPSDLFERR DFVQKTIEEF ARLMLAGIKG       120
     RRSSMNQSQL QGSERPIIFV ASCLGGVILM KMLVMATHEY DCVKKATRGF VFLATPFRGT       180
     SFEEVVFWAK PGLITRGLFR GKKPSNLMNY VMPARDLEIL VGQFSTVCED ENLTNDLFTF       240
     YETGVTSLPR KAIPYIPKAL AKLKPLVNSS SATLDFAKHP LPIEQPHVLV NKFQGPGDPG       300
     YCHVSDAVQG LVCKARSGRP IERAKAWIRD NRYSLRKLEI ERLSGKKLPM DQCYINLAIV       360
     EQQRSISQSD KTKTAFEYSP FSLQTRLNLM APGEETEANL PNIFEPREKR NGQRMTPNRI       420
     LIRGRAGVGK TTLCKKIVYE FTYGKMWHSL FEHVLWVPLR KLKLKERKKI AGYNFGHMFC       480
     HEFFSQIPST AEMEELSNAL WRTLGDGDNT KTLFLLDGLD EVSQDVNGDM RDFLEELLNQ       540
     PNVIVTSRPN AISTAFLRQP FDLELETIGF YPKQVTSYIE TAFTEIETGQ MDSQAVNNIE       600
     SFLETRQLMQ DLVRIPIQLD ALCYTWHEFQ RKTDAVPETM TGVYTAMELS LWKKDVVNLG       660
     RRTEVEIEFA SDGTIRKLVK LEAEALQLVA FTGMYNDIID FAPQHRDTIF EHVDSNCLDD       720
     QWLGRVSFLR TSDSSSDNRN RDYHFLHLTF QEYFAALHFV RKWKADEDLE FSNLATGEKI       780
     RISPAEFLGI NKYSARYDIV WRFVAGLLDL NGGPKEPERF FRALDQKPLD LLGIAHQRIV       840
     MNCLSEIQSE FSLRSKIESH LSKWLAFQCK TILEQDQRLL KESIITLASE IEFPENALTG       900
     LLKENDEKVM TVALLSVKKR HQIQSQIMEI ATSLLQRTKS SDVAISMFTF LRRQRENLSE       960
     ESLDLMVLHL QNPDRGVRLS AADTIRGFAL PDRTCRKVIE TGVIQRRRDN RFEGFEGMAL      1020
     SDQSMSKETL TDLIASLESP DKNIRRVASD VLSHRSDFLP EEVTSIMAKI EHQDSDVRWC      1080
     SFNALRGQSH SSGMFTGLLW PEVNGSSKKI SNCALEVLYQ LSNSSEDLLE RIIVELLPHR      1140
     SCWHILKSYC NRSRLSKKAL NALETHLGSP DYGLRCAAIN ILAGQPDLSF SILNRIVEQL      1200
     EDGTSKVRTA AVYAIRRQPR LPIETALEIA RRFKNDKLPS KIVLQIFEHQ SNSPKEVLVQ      1260
     IARCIEDQDV SIRSAAIRAL SGQSNLSDLP EIHEKVIAYI EDSDAEVREA AIQAVSVGRP      1320
     SMSDTTFDTI ATRMDDTNEK VRLAVVQVLG QKETLCFDIV NTLADLMNDT DEKVRWATLK      1380
     VLADQSTWPG AIRHKIASKV YCPLAFRVKR EEFHLNFLLG GLAKQILRLL LLRTSRMHLA      1440
     WYIHNDMSYV ERSDGSKAPL PCAGADIELG MMSAREEAGI PPVAVLYS                   1488
//

If you have problems or comments...

PBIL Back to PBIL home page