(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE471

PENCW_16.PE471       Location/Qualifiers
FT   CDS             join(1062362..1062527,1062593..1063293,1063357..1063629)
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000044165" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI20672211"
FT                   /orf_name="Pc20g04710"
FT                   /product="Pc20g04710 protein"
FT                   /function="asparaginase activity"
FT                   /biological_process="asparagine metabolic process "
FT                   /protein_id="CAP85800.1"
FT                   /db_xref="GO:0004067"
FT                   /db_xref="GO:0006528"
FT                   /db_xref="InterPro:IPR004550"
FT                   /db_xref="InterPro:IPR006034"
FT                   /db_xref="InterPro:IPR020827"
FT                   /db_xref="UniParc:UPI0001831769"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE41"
FT                   /transl_table=1
FT                   /translation="MGFSLQALTVSALAITSYASPLIHSRATNTSYTNSNGLTFNHFNG
FT                   SLPNVTILATGGTIAGTSDDKTATAGYESGALGINTLLSKIPEIFNVANIAAVQAHNVN
FT                   SGDISSSLLLNLTHTLQATVCDDPTMSGAVITHGTDTLEESAFFIDATVNCGKPIVFVG
FT                   SMRPATAISADGPMNLVQGVTVAADNDSRDRGALVVLNDRIVSALFATKTHANTMDTFK
FT                   AYEQGNLGFIVSNKPYFYYPAVQANVKHVVDVSNVDSVPRVDILYAYEDMQVDSLYSAM
FT                   KNGAKGIVVAGEGAGGVATDFGSAINDIVKKHNIPVVLSHRTVNGEVPTADFTGEDAQT
FT                   KIASGLFNPQQARILLGLLLAEKKGLKEIREVFLKATVA"
     MGFSLQALTV SALAITSYAS PLIHSRATNT SYTNSNGLTF NHFNGSLPNV TILATGGTIA        60
     GTSDDKTATA GYESGALGIN TLLSKIPEIF NVANIAAVQA HNVNSGDISS SLLLNLTHTL       120
     QATVCDDPTM SGAVITHGTD TLEESAFFID ATVNCGKPIV FVGSMRPATA ISADGPMNLV       180
     QGVTVAADND SRDRGALVVL NDRIVSALFA TKTHANTMDT FKAYEQGNLG FIVSNKPYFY       240
     YPAVQANVKH VVDVSNVDSV PRVDILYAYE DMQVDSLYSA MKNGAKGIVV AGEGAGGVAT       300
     DFGSAINDIV KKHNIPVVLS HRTVNGEVPT ADFTGEDAQT KIASGLFNPQ QARILLGLLL       360
     AEKKGLKEIR EVFLKATVA                                                    379
//

If you have problems or comments...

PBIL Back to PBIL home page