(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE472

PENCW_16.PE472       Location/Qualifiers
FT   CDS             join(complement(1065671..1065806),
FT                   complement(1065497..1065576),complement(1064925..1065407),
FT                   complement(1064020..1064859))
FT                   /evidence="3: Inferred from homology "
FT                   /gene_family="HOG000276708" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18978101"
FT                   /orf_name="Pc20g04720"
FT                   /product="Pc20g04720 protein"
FT                   /function="dihydrolipoyl dehydrogenase activity "
FT                   /function="flavin adenine dinucleotide binding "
FT                   /biological_process="cell redox homeostasis"
FT                   /biological_process="oxidation-reduction process "
FT                   /cellular_component="cytoplasm"
FT                   /protein_id="CAP85801.1"
FT                   /db_xref="GO:0004148"
FT                   /db_xref="GO:0005737"
FT                   /db_xref="GO:0045454"
FT                   /db_xref="GO:0050660"
FT                   /db_xref="GO:0055114"
FT                   /db_xref="InterPro:IPR001327"
FT                   /db_xref="InterPro:IPR004099"
FT                   /db_xref="InterPro:IPR006258"
FT                   /db_xref="InterPro:IPR012999"
FT                   /db_xref="InterPro:IPR013027"
FT                   /db_xref="InterPro:IPR016156"
FT                   /db_xref="UniParc:UPI000183176A"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE42"
FT                   /transl_table=1
FT                   /translation="MFRAVLPRATPRSALRHAGPRAIPNNFATSMIFIGQSKRGFASEA
FT                   GDHDLVIIGGGVAGYVAAIKAGQEGLKTACIEKRGKLGGTCLNVGCIPSKSLLNNSHLY
FT                   HQVLHDTKKRGIEVGDVKLNLTQMMKAKDTSVDGLTKGIEFLLKKNGVDYVKGAGSFVD
FT                   ANTIKVALNEGGEQTLRAKNIIIATGSEATGFPGLNIDEKRIITSTGALALTEVPKKMT
FT                   VIGGGIIGLEMASVWSRLGAEVTVVEFLGQIGGPGMDAEIAKQAQKILGKQGIKFKTGT
FT                   KVVSGDDSGSTISLNIEAAKGGKEEVLDADVVLVAIGRRPYTEGLNLEQVGIEKDDRGR
FT                   LVIDQEYRTKLPHIRVVGDCTFGPMLAHKAEEEAVAAIEYIKTGYGHVNYAAIPSVMYT
FT                   HPEVAWVGQNEAEIKASGVKYRVGSFPFSANSRAKTNLDTEGVVKFIADAETDRVLGVH
FT                   IIGPGAGEMIAEATLAIEYGASSEDIARTCHAHPTLSEAFKEAAMATYSKPIHF"
     MFRAVLPRAT PRSALRHAGP RAIPNNFATS MIFIGQSKRG FASEAGDHDL VIIGGGVAGY        60
     VAAIKAGQEG LKTACIEKRG KLGGTCLNVG CIPSKSLLNN SHLYHQVLHD TKKRGIEVGD       120
     VKLNLTQMMK AKDTSVDGLT KGIEFLLKKN GVDYVKGAGS FVDANTIKVA LNEGGEQTLR       180
     AKNIIIATGS EATGFPGLNI DEKRIITSTG ALALTEVPKK MTVIGGGIIG LEMASVWSRL       240
     GAEVTVVEFL GQIGGPGMDA EIAKQAQKIL GKQGIKFKTG TKVVSGDDSG STISLNIEAA       300
     KGGKEEVLDA DVVLVAIGRR PYTEGLNLEQ VGIEKDDRGR LVIDQEYRTK LPHIRVVGDC       360
     TFGPMLAHKA EEEAVAAIEY IKTGYGHVNY AAIPSVMYTH PEVAWVGQNE AEIKASGVKY       420
     RVGSFPFSAN SRAKTNLDTE GVVKFIADAE TDRVLGVHII GPGAGEMIAE ATLAIEYGAS       480
     SEDIARTCHA HPTLSEAFKE AAMATYSKPI HF                                     512
//

If you have problems or comments...

PBIL Back to PBIL home page