(data stored in ACNUC8465 zone)

HOGENOMDNA: PENCW_16.PE473

PENCW_16.PE473       Location/Qualifiers
FT   CDS             join(complement(1068248..1068496),
FT                   complement(1066897..1068177))
FT                   /evidence="4: Predicted"
FT                   /gene_family="HOG000167003" [ FAMILY / ALN / TREE ]
FT                   /gene_id="IGI18129269"
FT                   /orf_name="Pc20g04730"
FT                   /product="Pc20g04730 protein"
FT                   /biological_process="transmembrane transport"
FT                   /protein_id="CAP85802.1"
FT                   /db_xref="GO:0055085"
FT                   /db_xref="InterPro:IPR011701"
FT                   /db_xref="InterPro:IPR016196"
FT                   /db_xref="InterPro:IPR020846"
FT                   /db_xref="UniParc:UPI000183176B"
FT                   /db_xref="UniProtKB/TrEMBL:B6HE43"
FT                   /transl_table=1
FT                   /translation="MAEERGNEVDTKTPDLPSQHGDTRQQGYSQFTVAQKRAIVAMGSL
FT                   ASFFSPLSSSIYLPALTSIANSLHISISQVNLTVTTYLIMQGVAPMLIAGFSDTAGRRP
FT                   AYTICFAIYLAANLGLGLQNSYAALLVLRCLQSAGSSGTVALANGLVGDMITSAERGSY
FT                   IAFASVGSMLGPSLSPIIGGLISQYTDWHWIFWFLLIFGGVFFLVLGLFLPETCRKVVG
FT                   DGSIPPPPLNNSVADIIRHRTRKQKGLVPDPYKEAEVRKNYSLRFPSPVPTMKVLLDLE
FT                   TSVILLTTGLLFAGFYAVMTGASTSFHKIYQFNDLHAALMYLPIGGGGVLSAFTTGRLV
FT                   DWNYRRHAKRAGLTVVKNVRADIRNFNIERARLEVALPLYYISNLAMLTYGWVLGHKVN
FT                   LAAPVILLFIIGWSIIGTSQVLNALMVDLWPGKSAAATAANNLFRCELGAAASAAISPM
FT                   RSAMGEGWAYTTLALIPIAVSPCLWMVALNGIKWRQKRNRKEEEKSSCEQD"
     MAEERGNEVD TKTPDLPSQH GDTRQQGYSQ FTVAQKRAIV AMGSLASFFS PLSSSIYLPA        60
     LTSIANSLHI SISQVNLTVT TYLIMQGVAP MLIAGFSDTA GRRPAYTICF AIYLAANLGL       120
     GLQNSYAALL VLRCLQSAGS SGTVALANGL VGDMITSAER GSYIAFASVG SMLGPSLSPI       180
     IGGLISQYTD WHWIFWFLLI FGGVFFLVLG LFLPETCRKV VGDGSIPPPP LNNSVADIIR       240
     HRTRKQKGLV PDPYKEAEVR KNYSLRFPSP VPTMKVLLDL ETSVILLTTG LLFAGFYAVM       300
     TGASTSFHKI YQFNDLHAAL MYLPIGGGGV LSAFTTGRLV DWNYRRHAKR AGLTVVKNVR       360
     ADIRNFNIER ARLEVALPLY YISNLAMLTY GWVLGHKVNL AAPVILLFII GWSIIGTSQV       420
     LNALMVDLWP GKSAAATAAN NLFRCELGAA ASAAISPMRS AMGEGWAYTT LALIPIAVSP       480
     CLWMVALNGI KWRQKRNRKE EEKSSCEQD                                         509
//

If you have problems or comments...

PBIL Back to PBIL home page